SecReT6
Protein ID: 253987762
SecReT6 ID355
T6SS typei1
Gene symbol-
Locus tagPAU_00279
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]308610..311249 [-]
ProductClpA/B-type chaperone
NoteTssH
UniProt IDB6VM79
KEGG IDpay:PAU_00279
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.20E-40, Aligned region: 222..243
AAA_2 [PF07724], Evalue: 1.20E-40, Aligned region: 614..775
AAA [PF00004], Evalue: 2.20E-18, Aligned region: 32..63
AAA [PF00004], Evalue: 2.20E-18, Aligned region: 222..333
AAA [PF00004], Evalue: 2.20E-18, Aligned region: 620..738
AAA_5 [PF07728], Evalue: 9.50E-15, Aligned region: 222..249
AAA_5 [PF07728], Evalue: 9.50E-15, Aligned region: 619..737
ClpB_D2-small [PF10431], Evalue: 2.00E-14, Aligned region: 517..542
ClpB_D2-small [PF10431], Evalue: 2.00E-14, Aligned region: 781..858
AAA_16 [PF13191], Evalue: 1.00E-08, Aligned region: 199..241
AAA_16 [PF13191], Evalue: 1.00E-08, Aligned region: 253..300
AAA_16 [PF13191], Evalue: 1.00E-08, Aligned region: 410..485
AAA_16 [PF13191], Evalue: 1.00E-08, Aligned region: 478..561
AAA_16 [PF13191], Evalue: 1.00E-08, Aligned region: 596..657
AAA_16 [PF13191], Evalue: 1.00E-08, Aligned region: 685..713
AAA_16 [PF13191], Evalue: 1.00E-08, Aligned region: 800..848
AAA_22 [PF13401], Evalue: 3.30E-07, Aligned region: 221..307
AAA_22 [PF13401], Evalue: 3.30E-07, Aligned region: 486..486
AAA_22 [PF13401], Evalue: 3.30E-07, Aligned region: 618..638
AAA_22 [PF13401], Evalue: 3.30E-07, Aligned region: 681..713
DUF258 [PF03193], Evalue: 8.30E-05, Aligned region: 186..239
DUF258 [PF03193], Evalue: 8.30E-05, Aligned region: 620..637
AAA_25 [PF13481], Evalue: 0.00015, Aligned region: 222..244
AAA_25 [PF13481], Evalue: 0.00015, Aligned region: 614..648
AAA_14 [PF13173], Evalue: 0.00027, Aligned region: 222..304
AAA_14 [PF13173], Evalue: 0.00027, Aligned region: 619..708
Zeta_toxin [PF06414], Evalue: 0.00032, Aligned region: 222..241
Zeta_toxin [PF06414], Evalue: 0.00032, Aligned region: 461..514
Zeta_toxin [PF06414], Evalue: 0.00032, Aligned region: 618..659
AAA_29 [PF13555], Evalue: 0.00042, Aligned region: 215..238
AAA_29 [PF13555], Evalue: 0.00042, Aligned region: 617..633
IstB_IS21 [PF01695], Evalue: 0.002, Aligned region: 216..246
IstB_IS21 [PF01695], Evalue: 0.002, Aligned region: 619..630
NACHT [PF05729], Evalue: 0.002, Aligned region: 222..249
NACHT [PF05729], Evalue: 0.002, Aligned region: 461..470
NACHT [PF05729], Evalue: 0.002, Aligned region: 620..647
NACHT [PF05729], Evalue: 0.002, Aligned region: 796..839
AAA_19 [PF13245], Evalue: 0.0037, Aligned region: 219..243
AAA_19 [PF13245], Evalue: 0.0037, Aligned region: 613..638
Ras [PF00071], Evalue: 0.004, Aligned region: 222..235
Ras [PF00071], Evalue: 0.004, Aligned region: 620..660
AAA_17 [PF13207], Evalue: 0.0059, Aligned region: 222..242
AAA_17 [PF13207], Evalue: 0.0059, Aligned region: 620..654
Sigma54_activat [PF00158], Evalue: 0.0059, Aligned region: 221..238
Sigma54_activat [PF00158], Evalue: 0.0059, Aligned region: 619..717
Arch_ATPase [PF01637], Evalue: 0.0079, Aligned region: 202..303
Arch_ATPase [PF01637], Evalue: 0.0079, Aligned region: 475..499
Arch_ATPase [PF01637], Evalue: 0.0079, Aligned region: 620..640
Arch_ATPase [PF01637], Evalue: 0.0079, Aligned region: 690..701
MobB [PF03205], Evalue: 0.0085, Aligned region: 222..244
MobB [PF03205], Evalue: 0.0085, Aligned region: 619..639
Protein Sequence: 879 a.a.     [Download]
>gi|253987762|ref|YP_003039118.1| ClpA/B-type chaperone [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MIQIDLPTLVNRLNPMTRHALETAAAQCVSQQQPEITVSQLLLQMINTPLSDVRAIFSQAEVDSDLLKEQ
LDQMIPHHQAMVQAYPNFSPMLVEWLQDSWLLASTEMQHQELRSGVMLMTLLFSPLRYLTPQSARLLSGI
NRELLRQNFTQWTAGSAEQPVVENDKNGQGRNAANSDSLLARFTQNMTEQARQGKLDPVLCRDTEIDLMI
DILCRRRKNNPIVVGEAGVGKSALIEGLALRIIDNQVPEKLRNSELMTLDLGALQAGAAVKGEFEKRFKG
IMSEINQSSVPIILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWGEYKKYFEKDAALSR
RFQLVKVAEPTAEEAIIIMRGLRAIYEQSHGILIDDEALKASAVLSDRYLSGRQLPDKAIDVLDTACARV
AINLTSPPRQISALKNQLHQQQMESDVLTREQHMGLNQHTDRLEELQQQQQETAEKLAELETSWQQQQQL
VQQVIELRRQLLTNETTDKTEENETPAEIVTEELVAKLSELNQQLEQLQQQQTLVSPHVDKNQIAAVIAE
WTGVPLNRLSQSELSIVTELPTHLGQSIKGQQLAIKCLHQHLLTARADLRRPGRPLGAFLLVGPSGVGKT
ETVLQLAELMFGGRQYLTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGVLTEAIRQKPYSVVLLDEVEKA
HPDVLNLFYQAFDKGELADGEGRVIDCKNIVFFLTSNLGYQTIVDNADKPEEMNDLLYPELAAFFKPALL
ARMEVVPYLPLGYDTLKTIIQSKLARLDNLLRQRFNAEVTISDDVIEEILQRATRAENGARMLESIIDGA
LLPPLSLLLLQKMASGKQISAIQLTVDEHKFNAVVEELQ
 
Nucleotide Sequence: 2640 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c311249-308610 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGATCCAGATTGATCTCCCCACATTAGTTAACCGCTTAAATCCGATGACTCGGCATGCTCTGGAAACGG
CGGCAGCGCAGTGTGTCAGTCAGCAGCAACCTGAGATCACGGTCTCTCAGCTACTGTTGCAGATGATCAA
CACACCTCTCAGTGATGTCAGAGCGATCTTCAGTCAAGCCGAAGTAGACAGTGACTTGCTGAAAGAACAA
CTTGATCAGATGATTCCTCACCATCAGGCGATGGTACAAGCTTACCCCAACTTTTCACCCATGCTGGTGG
AATGGCTACAGGATAGCTGGCTGTTAGCATCAACCGAGATGCAGCATCAGGAATTACGCAGCGGTGTCAT
GCTGATGACATTATTATTCAGCCCATTACGCTACCTGACGCCCCAATCTGCCCGTTTGCTATCGGGAATT
AACCGCGAATTACTGCGCCAGAATTTTACGCAATGGACAGCAGGTTCCGCCGAACAACCGGTTGTAGAAA
ACGATAAAAACGGACAAGGCAGAAACGCAGCCAATAGTGACAGCCTTCTCGCCCGTTTTACCCAAAACAT
GACAGAACAGGCTCGTCAGGGAAAACTCGATCCAGTTCTGTGCCGTGACACCGAAATCGACCTGATGATC
GATATTCTTTGCCGCCGACGTAAAAATAACCCCATTGTGGTAGGTGAAGCGGGCGTAGGTAAAAGTGCGC
TGATTGAAGGACTGGCTTTGCGCATTATCGACAATCAGGTACCGGAAAAATTACGCAACAGTGAATTGAT
GACACTGGATCTGGGGGCATTACAAGCGGGTGCGGCGGTAAAAGGTGAATTTGAAAAGCGCTTCAAAGGC
ATCATGAGTGAAATCAACCAATCGTCTGTACCGATTATTCTATTTATCGATGAAGCTCATACGCTGATTG
GTGCAGGTAATCAGCAGGGCGGACTGGACATCTCTAACTTGCTGAAACCCGCTCTGGCACGTGGTGAATT
GAAAACTATCGCCGCAACCACTTGGGGCGAATACAAAAAATATTTTGAAAAAGATGCTGCCCTCTCTCGC
CGTTTTCAACTGGTCAAAGTGGCTGAACCCACAGCGGAAGAAGCCATTATCATTATGCGTGGCCTGCGGG
CAATTTATGAACAATCTCATGGCATATTGATCGATGACGAAGCACTGAAAGCCTCCGCCGTATTAAGTGA
CCGTTACCTCTCAGGTCGCCAGTTACCCGATAAAGCTATTGACGTATTAGATACCGCCTGTGCCCGCGTT
GCCATCAATCTGACTTCACCTCCACGTCAGATTTCCGCACTGAAAAATCAGCTCCACCAGCAGCAAATGG
AATCGGATGTGCTGACAAGAGAGCAACACATGGGGCTGAACCAACATACTGATAGACTAGAAGAACTTCA
GCAACAACAGCAGGAAACGGCAGAAAAACTGGCTGAACTGGAAACCAGTTGGCAACAACAACAGCAATTG
GTTCAACAAGTTATTGAACTACGCCGTCAACTATTAACAAACGAAACAACCGATAAAACCGAAGAGAACG
AGACACCTGCGGAAATCGTGACTGAAGAATTGGTTGCAAAACTGTCTGAACTTAATCAACAACTGGAACA
GTTACAACAACAGCAAACACTGGTTTCCCCTCATGTGGATAAAAACCAAATTGCGGCAGTTATCGCCGAA
TGGACAGGCGTTCCCCTTAACCGTCTGTCACAGAGTGAATTATCCATTGTCACTGAACTGCCAACCCATC
TGGGGCAAAGCATCAAAGGACAGCAACTAGCTATCAAATGCCTGCATCAACATCTATTAACTGCCAGAGC
AGACCTGCGCCGTCCTGGTCGCCCACTGGGGGCCTTCCTGCTAGTGGGGCCAAGCGGTGTCGGTAAAACT
GAGACCGTTTTACAGCTTGCGGAATTAATGTTCGGCGGACGTCAGTACCTGACCACCATCAACATGTCCG
AGTTTCAGGAAAAACACACCGTTTCTCGCCTGATTGGTTCACCGCCAGGCTATGTTGGATATGGAGAAGG
TGGCGTACTCACCGAAGCTATTCGCCAGAAACCTTATTCCGTCGTCCTACTTGATGAAGTGGAAAAAGCG
CATCCTGACGTACTCAACCTGTTCTATCAAGCATTCGACAAAGGCGAACTGGCCGATGGCGAAGGCCGAG
TGATTGACTGCAAAAATATTGTCTTCTTCCTGACATCCAACCTTGGCTATCAAACTATCGTTGATAATGC
TGATAAACCGGAAGAGATGAACGACCTGCTCTACCCTGAACTGGCGGCATTCTTCAAACCGGCATTACTG
GCGCGAATGGAAGTCGTGCCCTATCTGCCACTGGGATATGACACCCTGAAGACCATCATTCAAAGCAAAC
TAGCTCGCCTTGATAACCTGTTGCGCCAACGTTTCAATGCTGAAGTAACCATCAGTGATGACGTGATCGA
AGAAATACTGCAACGAGCAACCCGTGCTGAAAACGGTGCACGTATGCTGGAATCGATCATTGATGGCGCT
TTGTTACCACCGCTATCTCTGCTATTGCTGCAAAAAATGGCTTCAGGAAAACAAATTAGCGCCATCCAGC
TAACCGTTGATGAACATAAATTCAACGCGGTGGTTGAGGAGCTCCAATGA
 Primer design