SecReT6
Protein ID: 253987763
SecReT6 ID355
T6SS typei1
Gene symbol-
Locus tagPAU_00280
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]311260..312030 [-]
Producthypothetical protein
NoteTssL
UniProt IDB6VM80
KEGG IDpay:PAU_00280
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.90E-62, Aligned region: 35..240
Protein Sequence: 256 a.a.     [Download]
>gi|253987763|ref|YP_003039119.1| hypothetical protein PAU_00280 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MKNEAINDNAILMQVETDTTLHRQYQLPLRGESLNPMIDAATPLLGMVMRLKDMGDEALPDQLYQQVVTD
IQAIEQFLQTKGYEPGAIVSFRYMLCTFIDETALGHGWNSQNGWLQQSLLVQFHNETWGGEKVFVLLERL
MGEPQRYQHLLEFIYLCFCLGYRGRYKVSSQKGDDFERLFRRIHQQLHALRGEAPPTILHSNANEQDSRY
RLGKRLTIKHLFWSGIGLLAVVYGFYAVRLHNQTQNILQQLNNLLS
 
Nucleotide Sequence: 771 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c312030-311260 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGAAGAACGAAGCTATCAACGACAACGCCATTCTGATGCAAGTAGAAACTGATACGACTTTGCACCGTC
AGTATCAGTTACCGTTGCGCGGAGAAAGCCTAAACCCGATGATTGATGCCGCAACACCGCTGCTCGGTAT
GGTCATGCGTCTAAAAGACATGGGTGATGAGGCGCTACCGGACCAGCTTTATCAGCAAGTCGTCACTGAT
ATCCAGGCAATCGAACAATTTTTACAAACCAAAGGTTATGAACCGGGCGCAATTGTCTCTTTTCGCTACA
TGCTCTGTACTTTCATTGATGAAACTGCACTGGGTCATGGCTGGAACAGCCAGAACGGTTGGTTGCAACA
ATCTCTACTGGTGCAATTCCACAATGAAACCTGGGGTGGTGAAAAAGTCTTTGTGCTGCTGGAGCGTTTG
ATGGGTGAACCTCAACGTTATCAGCATCTGCTGGAATTTATCTATCTCTGCTTCTGCCTCGGCTACCGTG
GTCGCTACAAAGTGAGTTCGCAGAAAGGGGATGATTTTGAACGTTTATTCCGCCGGATACATCAACAGTT
ACACGCGCTGCGGGGCGAAGCACCACCAACCATTCTGCACAGTAATGCCAACGAGCAGGACAGCCGCTAC
CGTTTGGGTAAGCGACTGACTATCAAACACCTCTTCTGGAGCGGTATTGGTCTGCTCGCCGTGGTTTATG
GCTTTTATGCTGTCCGGCTGCACAACCAAACCCAGAACATATTACAACAGCTAAATAATTTACTGAGTTA
G
 Primer design