SecReT6
Protein ID: 253987764
SecReT6 ID355
T6SS typei1
Gene symbol-
Locus tagPAU_00281
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]312030..313382 [-]
Producthypothetical protein
NoteTssK
UniProt IDB6VM81
KEGG IDpay:PAU_00281
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 5.90E-148, Aligned region: 19..446
Protein Sequence: 450 a.a.     [Download]
>gi|253987764|ref|YP_003039120.1| hypothetical protein PAU_00281 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MPGKNRVIWREGLFIKPQHFQQQQKHNDYLAHNRLTSLTSYGYGFSSLTIDKDLLALGRIGIIEASGIMP
DGTVFSVPYQDAIPQPLDVVNLHENNSKDIYLALPIASDTLNEISHPESNNAGAMRYREHVNDIRDLHTD
GGDVSQIMLAQLTPILKQGSEDLSAFTVLPLCQIIEKLPTGTIILNEDFVPTCTSINVSSKLKSYMDEVD
RALIERARSLANRIGSPGQQGVADVAEFMMLQLVNRIQPWFTHYARQTILHPEHFFTQLIQTCGELRTFT
HESRQVGDIPEYNHDSLTDTFHQVMRSMREAMGVVLTPRAIPIKLQTQSNGIRVANIHDRDVLTKADFIL
AIRAEVPQEQLLRQFVKQTKIASQERIREMVSVQLPGVGLIPLPAAPRQLPYHAGYTYFRFDQQGAAWQD
ILKGTSIAFHVSGDFPGLDLQFWAVRNGSD
 
Nucleotide Sequence: 1353 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c313382-312030 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGCCAGGTAAAAATCGGGTGATTTGGCGTGAAGGATTATTCATCAAGCCACAACATTTCCAACAACAAC
AAAAACATAATGACTATTTAGCTCACAACCGCCTGACGTCCCTCACCAGTTATGGTTATGGCTTCAGTTC
TCTGACTATTGACAAGGATCTCCTCGCACTGGGACGCATCGGTATCATCGAAGCCAGCGGTATCATGCCA
GATGGTACCGTGTTCTCTGTTCCATATCAGGATGCCATTCCCCAGCCTCTTGATGTCGTGAATCTCCACG
AAAACAATAGCAAAGATATCTATCTGGCACTGCCAATAGCCAGCGATACCCTCAATGAAATTTCCCACCC
AGAATCCAATAATGCTGGGGCGATGCGCTACCGCGAACATGTCAATGATATCCGTGACCTACACACGGAT
GGCGGTGATGTCAGCCAGATTATGCTGGCACAACTGACACCGATTTTGAAGCAAGGTTCAGAAGATCTCA
GCGCTTTTACCGTACTTCCTCTATGCCAGATAATCGAAAAGCTTCCGACGGGAACCATTATCTTGAATGA
AGATTTCGTGCCAACCTGTACGTCTATCAATGTTTCCTCCAAACTGAAAAGTTATATGGATGAAGTGGAT
AGGGCACTGATAGAACGGGCCAGATCACTCGCTAACCGGATCGGTTCTCCCGGTCAGCAAGGGGTAGCAG
ATGTTGCTGAATTTATGATGCTCCAGTTAGTTAACCGGATTCAGCCATGGTTTACCCACTACGCCAGACA
AACCATTCTGCATCCCGAACACTTCTTCACCCAGTTGATCCAAACCTGTGGTGAACTGAGAACATTCACA
CATGAATCCCGTCAGGTGGGAGATATACCGGAATATAATCACGACAGCCTGACTGATACATTCCATCAAG
TCATGCGTTCCATGCGTGAAGCAATGGGTGTTGTCCTGACCCCACGTGCGATCCCAATTAAGCTACAGAC
TCAGTCAAATGGCATCCGAGTAGCAAATATCCATGACCGAGATGTATTGACCAAAGCAGATTTCATTCTA
GCCATCCGCGCAGAAGTCCCACAGGAGCAATTACTCCGCCAGTTCGTTAAGCAGACCAAAATCGCATCTC
AGGAAAGAATCCGCGAAATGGTCAGCGTTCAGTTGCCTGGCGTAGGACTGATTCCGCTTCCTGCCGCTCC
GCGCCAATTGCCTTATCACGCCGGCTACACCTATTTCCGTTTTGATCAACAAGGTGCGGCATGGCAAGAC
ATTCTCAAAGGCACCTCCATTGCCTTCCATGTTTCAGGTGATTTCCCCGGATTAGACCTGCAATTCTGGG
CAGTCAGAAATGGGAGTGACTAA
 Primer design