SecReT6
Protein ID: 253987765
SecReT6 ID355
T6SS typei1
Gene symbol-
Locus tagPAU_00282
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]313385..313939 [-]
Producthypothetical protein
NoteTssJ
UniProt IDB6VM82
KEGG IDpay:PAU_00282
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 6.50E-38, Aligned region: 19..177
Protein Sequence: 184 a.a.     [Download]
>gi|253987765|ref|YP_003039121.1| hypothetical protein PAU_00282 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MKRSGNTSWSGIWLVLLAALVLSGCSGAWQATKKVGQVVWDPSTPVGQPADLPSTAAITLLAEPDINPNK
NGEATPVEIHLIYLSEDSRLLAADYDQLKSDELDKALGKNYIDHQDYTLLPGQYKPLPVIPLEKKSRYIG
VIVRYADINQSEWKKVIRVKDTGQQYNILVHIRANEVELRKEEQ
 
Nucleotide Sequence: 555 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c313939-313385 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGAAGCGCTCCGGTAATACCTCATGGTCTGGCATATGGCTTGTATTGCTGGCAGCGCTCGTGTTAAGCG
GTTGCAGCGGTGCATGGCAGGCAACGAAGAAAGTCGGACAGGTTGTCTGGGACCCATCAACTCCTGTCGG
TCAACCGGCGGATTTACCTTCCACTGCTGCGATCACTTTGCTGGCAGAGCCTGACATCAACCCCAATAAA
AATGGAGAAGCCACTCCGGTTGAAATACACCTGATTTATCTCAGTGAAGATTCCCGTCTGCTTGCCGCCG
ATTATGACCAGCTTAAAAGTGACGAATTAGATAAAGCGCTGGGGAAAAATTACATCGACCATCAGGATTA
CACCTTATTGCCGGGGCAATACAAACCACTACCCGTCATCCCGCTGGAAAAAAAGAGCCGTTACATCGGC
GTCATCGTTCGTTATGCCGATATCAATCAATCTGAATGGAAAAAAGTCATCCGAGTGAAAGACACGGGGC
AGCAATACAACATTCTGGTGCACATCAGAGCGAACGAAGTTGAACTTAGAAAAGAGGAACAATAA
 Primer design