SecReT6
Protein ID: 253987766
SecReT6 ID355
T6SS typei1
Gene symbol-
Locus tagPAU_00283
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]313939..315225 [-]
Producthypothetical protein
NoteFha
UniProt IDB6VM83
KEGG IDpay:PAU_00283
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 428 a.a.     [Download]
>gi|253987766|ref|YP_003039122.1| hypothetical protein PAU_00283 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MEKQQPTLSLRVLNSDQLESGKSASCLFSIQGGTVGSSESHLWSVQDQQGNINPSQFTIQWRDGAFCLHM
IAGPLFVNKSPLTPGAGLIRLQQADEITIGKLVIKSHISFSDADRTDPMMVSPESLVSSYSNPLDAMMEK
SPVQDSAFTEHHSPAPTINHDFSHDPLKVLDSETLTTQNQTSVTNEVDQSLQQGHYRTPLFFSPLSDNRG
NAMDRDFVDLPSISSPLSEQYQDMEQQHVAITPLMRGLNTQLPLHNSQQANDFLEEMGKTMKAAIEGLLA
LQRTQHGLRDKQLRPIEDNPLRLNMDYNTTMQVMFADQKSPVHLSAPSAVAESLQNLQLHYQANRIAITA
ALNTMLDAFSPEHLLSRFAQYRRSNETQEKDSTWAWEMYTSYYRELASSRQQGFEKLFSEVYEQAYDRAL
RQGLEDSQ
 
Nucleotide Sequence: 1287 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c315225-313939 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGGAAAAACAACAACCAACCCTTTCATTAAGAGTGCTCAACAGCGATCAACTGGAAAGCGGTAAATCTG
CCAGTTGCTTGTTCTCCATTCAAGGTGGCACAGTCGGTAGTAGCGAAAGCCATCTCTGGTCCGTTCAGGA
TCAACAGGGCAATATCAATCCGTCACAATTTACTATTCAGTGGCGTGATGGTGCATTCTGCCTGCACATG
ATCGCCGGCCCCCTATTTGTGAATAAATCACCACTAACTCCGGGGGCCGGCCTGATCCGACTGCAACAAG
CGGATGAAATTACCATCGGTAAGCTAGTGATCAAAAGCCATATCAGTTTTTCCGACGCAGATCGGACTGA
TCCAATGATGGTATCACCGGAATCATTGGTCTCCAGCTATAGCAATCCACTGGACGCCATGATGGAAAAA
TCACCCGTTCAGGATAGCGCTTTCACAGAACATCATTCTCCGGCACCAACAATAAACCATGATTTCAGTC
ACGACCCACTGAAGGTCCTCGACAGCGAAACACTAACCACACAGAACCAAACATCAGTAACTAACGAGGT
AGACCAAAGCCTGCAACAAGGCCATTACCGCACACCATTATTTTTCTCTCCCCTCTCAGATAACAGAGGC
AATGCTATGGATCGGGATTTTGTTGATTTACCGAGTATCTCTTCACCTTTAAGTGAACAATATCAAGATA
TGGAACAACAGCACGTTGCTATCACACCACTGATGCGAGGGCTAAACACACAATTACCTTTGCATAATAG
CCAGCAAGCCAACGACTTCCTGGAAGAAATGGGTAAAACCATGAAAGCAGCAATTGAAGGTTTACTGGCA
TTACAGCGTACACAGCATGGTCTGCGTGATAAACAACTGCGCCCTATCGAAGATAATCCGCTACGGCTAA
ATATGGATTACAACACCACCATGCAAGTGATGTTCGCTGATCAGAAAAGCCCGGTACATCTTTCAGCGCC
ATCAGCCGTCGCTGAAAGCTTACAGAACCTGCAATTACACTATCAGGCTAACCGGATTGCGATTACTGCC
GCATTGAACACTATGCTGGATGCTTTCTCACCAGAGCACCTACTTAGCCGTTTTGCCCAGTACCGCCGCA
GTAATGAGACCCAGGAAAAAGATTCCACCTGGGCATGGGAAATGTACACCAGTTACTACCGTGAATTGGC
TTCCAGCCGTCAACAGGGATTCGAAAAGCTGTTTAGTGAAGTTTACGAACAAGCTTATGACCGCGCTCTA
CGCCAAGGTTTAGAGGATAGCCAGTAA
 Primer design