SecReT6
Protein ID: 253987767
SecReT6 ID355
T6SS typei1
Gene symbol-
Locus tagPAU_00284
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]315232..316212 [-]
Producthypothetical protein
NoteTssG
UniProt IDB6VM84
KEGG IDpay:PAU_00284
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.70E-88, Aligned region: 2..313
Protein Sequence: 326 a.a.     [Download]
>gi|253987767|ref|YP_003039123.1| hypothetical protein PAU_00284, partial [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
LSKYNFYQLVELLNQLAVAWEKTGQTNRPDRESILFKSSASLAFPTRDVVSVKRTEQGRFQVEVSFLGLH
GSQSPMPGYYLDSLAWEEAQDENRLTNFLNIFNHRSIVMLHQIWRKYRYYICFDKNGMDDFSQRMFALVG
LGSDVNRSHLQINHSKMLAYAGLLASPGRSPEVISSLVSHCFDLSDVTVHGWQIRKTTIETSQQNRLGGL
LKIRGQKKGIEQSVLGRNFFLGSWVKGCNGKFLLCINNLSREHFLSFLPDGKNFLPLVMFICFVLRDQLA
WDLRLGLAENQADGMVLGTKQNNSLGWTSFLGKPEKKPFITISVGR
 
Nucleotide Sequence: 981 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c316212-315232 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
TTATCAAAATATAACTTTTACCAGTTGGTCGAGTTACTCAACCAATTGGCGGTAGCGTGGGAAAAAACAG
GGCAGACCAATCGCCCTGACCGAGAATCAATCCTCTTCAAATCCAGTGCAAGCTTAGCTTTTCCAACCAG
AGATGTTGTCTCTGTGAAACGTACCGAGCAAGGTCGTTTTCAGGTAGAGGTCTCCTTTCTTGGGCTACAT
GGCAGCCAGTCGCCTATGCCTGGTTATTACCTTGATTCGTTGGCATGGGAAGAGGCTCAAGACGAAAATC
GGCTGACTAATTTTCTGAATATTTTCAATCATCGCTCAATCGTCATGCTTCATCAGATCTGGCGGAAATA
TCGCTATTACATCTGTTTTGACAAAAACGGAATGGATGATTTTTCTCAACGCATGTTCGCTTTAGTCGGA
CTTGGCAGCGATGTGAACCGCTCTCATCTGCAAATCAATCACAGCAAAATGCTGGCCTACGCAGGTCTGT
TAGCCAGCCCTGGCCGATCGCCGGAAGTGATATCCAGTCTGGTTTCACATTGCTTTGATCTATCGGATGT
CACGGTACATGGCTGGCAAATTAGAAAAACCACCATCGAGACATCACAGCAAAACCGCCTGGGTGGACTA
TTGAAAATAAGGGGCCAGAAAAAAGGGATTGAACAATCCGTACTGGGCAGAAACTTCTTTCTCGGTTCTT
GGGTGAAAGGTTGCAACGGTAAGTTTCTGCTATGCATCAATAATCTCTCCCGAGAACACTTCCTGTCATT
TCTCCCGGACGGCAAAAATTTCCTACCACTAGTGATGTTTATTTGTTTTGTCCTGCGTGATCAATTGGCC
TGGGATCTACGTCTTGGACTAGCCGAAAACCAGGCAGATGGCATGGTACTTGGCACGAAACAAAACAACA
GCTTGGGGTGGACCAGCTTTCTCGGCAAACCAGAGAAGAAACCCTTTATCACTATTTCAGTTGGCAGATA
A
 Primer design