SecReT6
Protein ID: 253987768
SecReT6 ID355
T6SS typei1
Gene symbol-
Locus tagPAU_00285
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]316248..318077 [-]
Producthypothetical protein
NoteTssF
UniProt IDB6VM85
KEGG IDpay:PAU_00285
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.90E-208, Aligned region: 3..609
Protein Sequence: 609 a.a.     [Download]
>gi|253987768|ref|YP_003039124.1| hypothetical protein PAU_00285 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MSLEKYFREELDYLRQLGRQAAIEHPHLASFLSEQGSDPDVERLLEGFAFLAGNLRAKIDDQFPELTHGL
LHMLWPNYLRPTPSMTIIQYTPDESVVTKATQIKRGVQIKSHLLADDDEDIYSTNTDPNKAERDNRCTFT
LCRDVWLFPMSIRDISVNNSNEQGVIGLNFTSKTELNLQELQLDKLRFYLSGDDYSSTQLYFWLSYYLED
AKLTVGDITIPLPDFDFVPVGFNREDALLPYPKNSYMGYRILQEYFCFSEGFLFFDVTGFPKLPANLKAK
DFTLNLYFSEALPPEVKIRQDSFRLHCVPAINLFTMDSEAIRLDNSQAEYPLRASYSHPDRYDIFSVDKV
ESWLLNADGTPNRARGSERVYVPFESFHHQIEHESELNTRYFRIRVKESPFRKGLEHYISFVRGDESQLL
LNNENVSVRLTCTNRELPLQLRVGDINFPSLGSPSFAAFRNITRPSVPLYPLMSGKFHWSLISNMSLNYM
TLLDKDALKQVLSTYDLPSRHNRQSSRSSQKRLDAIERIETRPIDRLLRGLPVRGLESTLYIQQQAFSSE
GELYLFSTILSRFFALYASINSFHILKVINLDNQECYQWPEQIGQHALM
 
Nucleotide Sequence: 1830 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c318077-316248 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGTCACTTGAAAAATACTTCAGAGAGGAATTGGATTACCTGAGACAACTGGGGCGTCAAGCCGCAATTG
AACATCCTCATCTCGCTTCATTTCTATCTGAACAAGGCTCTGATCCGGATGTTGAACGTCTGTTGGAAGG
TTTTGCATTCCTGGCCGGTAACTTACGAGCAAAAATTGATGATCAATTCCCTGAACTGACTCATGGCTTA
TTACACATGCTATGGCCGAATTATCTACGGCCAACCCCCAGCATGACCATTATCCAGTACACACCCGATG
AAAGCGTTGTCACAAAAGCCACGCAGATTAAACGCGGAGTTCAAATCAAAAGCCATCTGCTGGCGGATGA
TGACGAAGATATTTACTCAACTAATACCGATCCTAACAAAGCAGAAAGAGACAATCGCTGTACTTTTACT
TTATGCCGTGATGTCTGGCTGTTCCCAATGTCAATCCGGGACATTTCCGTTAATAACAGCAATGAACAAG
GTGTTATCGGTTTAAATTTTACCTCAAAGACAGAACTCAACTTACAAGAATTACAACTTGATAAGCTACG
TTTTTATCTGAGCGGTGACGATTACAGCAGTACACAACTCTATTTCTGGCTTAGTTACTACCTTGAAGAC
GCAAAACTCACCGTAGGCGATATCACCATTCCATTGCCGGATTTTGATTTCGTTCCAGTTGGCTTTAACC
GGGAAGATGCCCTGCTGCCTTATCCCAAAAATTCCTATATGGGTTATCGCATCTTGCAGGAGTATTTCTG
CTTTTCTGAAGGTTTCTTGTTTTTTGATGTCACTGGCTTCCCTAAATTACCGGCAAATCTTAAAGCCAAA
GATTTCACGCTGAATCTCTATTTCTCAGAGGCACTCCCGCCGGAAGTTAAAATCCGTCAAGATAGTTTTC
GACTACATTGTGTTCCAGCAATCAATCTTTTCACCATGGATAGCGAAGCTATTCGATTAGATAACAGCCA
AGCTGAATACCCACTGAGGGCTAGCTATAGTCATCCTGATCGCTATGATATTTTCTCCGTTGATAAAGTA
GAAAGCTGGCTACTTAATGCCGATGGTACACCCAACCGCGCCAGGGGTAGTGAACGGGTCTACGTTCCAT
TTGAAAGTTTTCATCACCAAATCGAACACGAAAGTGAACTCAATACCCGCTATTTCCGCATCAGGGTCAA
AGAATCCCCTTTCCGCAAGGGGCTTGAGCACTACATCTCTTTTGTTCGTGGTGATGAATCTCAACTCCTG
TTAAATAATGAAAATGTCTCTGTCAGGTTGACCTGTACCAACCGTGAACTGCCACTGCAACTACGAGTGG
GTGACATTAATTTTCCGTCACTGGGCAGTCCGTCATTTGCAGCATTCCGCAATATCACCCGCCCATCTGT
TCCACTTTATCCATTAATGAGCGGTAAATTTCACTGGTCTCTCATTTCCAATATGTCGCTGAATTATATG
ACATTGTTGGATAAGGACGCACTAAAGCAAGTACTGAGTACCTATGATCTGCCGAGTCGACATAACCGGC
AGTCATCGCGGTCATCCCAAAAACGGCTGGATGCAATTGAACGAATTGAAACTCGACCAATAGACCGCCT
GTTAAGAGGGCTTCCTGTGCGGGGGCTGGAATCAACATTGTATATCCAACAACAGGCTTTTAGCTCTGAG
GGTGAGCTCTATCTGTTCAGCACCATACTGTCACGCTTCTTTGCATTATATGCCAGCATCAATTCCTTCC
ACATATTGAAGGTGATCAACTTAGATAATCAGGAATGTTATCAATGGCCGGAACAGATAGGTCAACATGC
GTTGATGTAA
 Primer design