SecReT6
Protein ID: 253987769
SecReT6 ID355
T6SS typei1
Gene symbol-
Locus tagPAU_00286
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]318080..318520 [-]
Producthypothetical protein
NoteTssE
UniProt IDB6VM86
KEGG IDpay:PAU_00286
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.10E-21, Aligned region: 31..122
Protein Sequence: 146 a.a.     [Download]
>gi|253987769|ref|YP_003039125.1| hypothetical protein PAU_00286 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MAALYSWNREGSASLFERIQGKNSGSSRQSRMRELLNSVKRHLNNILNTHPGACQSAVDLGVIDLNDATT
TATDFKQSIEQAIEHCIRNYEPRISSVSVSAIHDDSDPLLLSFHISAQVSLDDIHDVVEFNIQLDNNRRY
CLERTQ
 
Nucleotide Sequence: 441 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c318520-318080 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGGCTGCGCTGTACAGTTGGAATAGAGAGGGCTCTGCCAGCTTGTTTGAGCGTATTCAGGGGAAGAACT
CCGGTTCTTCCCGCCAGTCCAGAATGCGTGAGCTACTTAACTCCGTAAAACGGCACCTGAATAATATTCT
CAATACCCATCCAGGTGCTTGCCAGAGCGCGGTTGATCTCGGCGTTATTGATCTCAATGATGCCACAACC
ACTGCGACTGACTTTAAACAGAGTATTGAACAGGCAATAGAGCACTGCATCAGAAATTATGAACCAAGAA
TATCGTCAGTCTCTGTCAGCGCAATCCATGATGACAGTGACCCACTGCTGTTAAGTTTTCACATCAGTGC
CCAGGTATCCCTGGATGATATTCATGACGTTGTTGAATTTAACATTCAACTGGATAACAACCGGCGTTAT
TGCCTAGAGCGGACTCAATAA
 Primer design