SecReT6
Protein ID: 253987770
SecReT6 ID355
T6SS typei1
Gene symbol-
Locus tagPAU_00287
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]318527..320005 [-]
Producthypothetical protein
NoteTssC
UniProt IDB6VM87
KEGG IDpay:PAU_00287
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.70E-187, Aligned region: 65..490
Protein Sequence: 492 a.a.     [Download]
>gi|253987770|ref|YP_003039126.1| hypothetical protein PAU_00287 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MSLHEESSTTLAPGSTTSLLDEIMSQARMTPENDGYHIAKQGVAAFISSILDTGSNEEPINKLVVDRMIV
ELDKTLSTQVDEIMHAKEFQELESSWRSLKLLVDRTDFRENIKINIIHATKEELLEDFEFSPEIIQSGLY
KHVYSTGYGQFGGEPVAAVIGNYAFSNSSPDIKLMQYVSAVGAMAHAPFLSSVAPDFFGISSFTELPAIK
DLKSVFEGPAHTKWRALRESEDSRYLGLTTPRFLLRLPYSTVENPIKNFNYQEDVSKDHEHFLWGNTAYL
LATCLTDSFAKYRWCPNIIGPQSGGTVSDLPVHLFEAMGQIQAKIPTEVLITDRREFELAEEGFITLTMR
KGSDNAAFFSANSVQKPKVFPNTREGKMAETNYKLGTQLPYMFIINRLAHYIKVLQREQIGSWKERQDLE
RELNTWLKQYIADQENPPTDVRSRRPLRSAQIQVLDVEGDPGWYQVAMQVRPHFKYMGASFELSLVGRLD
KE
 
Nucleotide Sequence: 1479 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c320005-318527 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGTCTTTACATGAAGAGAGCAGTACAACATTAGCCCCAGGCTCCACTACCTCTTTGCTTGACGAAATCA
TGTCTCAGGCAAGAATGACGCCAGAAAATGACGGCTACCATATTGCAAAACAAGGTGTTGCCGCTTTTAT
TAGCAGCATTTTGGATACAGGCTCTAACGAGGAACCTATCAACAAGCTTGTGGTTGACAGAATGATTGTT
GAGCTTGATAAAACGCTCAGCACTCAGGTCGATGAAATCATGCACGCTAAAGAATTCCAGGAACTGGAAT
CATCATGGCGTTCACTGAAGTTATTAGTTGATCGTACAGATTTCCGTGAAAACATTAAGATCAACATTAT
CCATGCCACCAAAGAAGAATTACTGGAAGATTTCGAGTTCTCACCAGAAATCATTCAATCAGGCTTATAT
AAACATGTTTACTCAACCGGTTATGGCCAGTTTGGTGGTGAACCTGTTGCCGCAGTCATTGGTAACTATG
CCTTTAGTAATAGCTCACCGGATATCAAACTGATGCAATATGTCAGTGCGGTTGGAGCGATGGCTCACGC
GCCATTCCTTTCTTCCGTTGCGCCTGATTTCTTTGGCATCAGCAGCTTTACAGAACTGCCCGCAATTAAA
GATCTAAAATCCGTTTTCGAAGGTCCAGCACACACTAAATGGCGTGCACTACGCGAATCTGAAGATTCAC
GTTATCTCGGACTGACAACGCCACGTTTCCTGTTACGTCTGCCATATTCAACGGTGGAAAACCCAATTAA
GAACTTTAACTATCAGGAAGACGTCAGCAAAGATCACGAACATTTCCTGTGGGGCAATACCGCTTATCTG
CTGGCAACCTGCCTGACAGACAGCTTCGCCAAATATCGCTGGTGTCCGAACATTATCGGTCCACAAAGCG
GTGGTACTGTTAGCGATCTACCGGTTCACCTGTTCGAAGCCATGGGGCAAATCCAAGCCAAGATCCCAAC
AGAAGTTTTAATTACTGATCGCCGTGAATTTGAATTGGCGGAAGAAGGTTTTATCACCCTGACGATGCGT
AAAGGCAGTGACAATGCCGCATTCTTCTCTGCCAACTCAGTTCAGAAACCCAAAGTGTTCCCAAATACGC
GCGAAGGGAAAATGGCGGAAACCAACTACAAATTGGGTACTCAACTGCCATATATGTTCATTATCAACCG
CCTTGCACACTACATCAAAGTGTTACAGCGCGAGCAAATTGGTTCCTGGAAAGAGCGTCAGGATCTAGAG
CGTGAGCTAAACACCTGGCTGAAACAATACATCGCTGATCAGGAAAATCCACCAACTGATGTCCGTAGCC
GTCGTCCTCTGCGCTCCGCCCAAATTCAGGTTTTGGACGTGGAAGGAGATCCAGGTTGGTACCAAGTGGC
AATGCAAGTTCGCCCTCATTTCAAATATATGGGTGCGAGCTTTGAGTTGTCATTGGTAGGACGATTGGAT
AAGGAATAA
 Primer design