SecReT6
Protein ID: 253987771
SecReT6 ID355
T6SS typei1
Gene symbol-
Locus tagPAU_00288
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]320029..320526 [-]
Producthypothetical protein
NoteTssB
UniProt IDB6VM88
KEGG IDpay:PAU_00288
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 7.60E-58, Aligned region: 8..160
Protein Sequence: 165 a.a.     [Download]
>gi|253987771|ref|YP_003039127.1| hypothetical protein PAU_00288 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MSKNSPGSVAPKERINIKYVPNTGDQVAEIELPLNLLIVGDLKGTKEDTPIEERQAVSVHKNNFNAVMNE
ANINLTFSVPNRLNDNNGDDLPVNLEIKSLNDFSPDNVAKKVPELNKLLELREALVALKGPLGNIPAFRT
RLQELLGDEKVREQLLKELEIVNPK
 
Nucleotide Sequence: 498 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c320526-320029 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGAGTAAAAATAGCCCAGGTAGTGTAGCGCCAAAGGAAAGGATTAATATCAAGTATGTTCCTAATACCG
GCGATCAAGTCGCAGAAATCGAATTACCACTTAATCTACTTATCGTCGGTGATCTGAAAGGAACAAAAGA
GGACACACCAATTGAAGAGCGGCAAGCTGTTTCTGTTCACAAAAATAACTTTAATGCCGTGATGAATGAA
GCAAATATCAACCTAACATTCAGTGTCCCCAATCGCCTCAACGATAATAATGGAGATGACCTGCCAGTTA
ACTTAGAAATAAAATCACTAAATGATTTTTCACCCGATAACGTAGCCAAGAAAGTTCCTGAATTAAATAA
ACTTTTAGAATTGCGTGAAGCTCTTGTCGCCCTAAAAGGGCCACTGGGCAATATTCCAGCATTCCGCACC
CGTTTACAGGAATTACTGGGTGATGAAAAAGTGAGGGAACAACTTCTAAAAGAACTTGAAATTGTCAACC
CAAAGTAA
 Primer design