SecReT6
Protein ID: 253989749
SecReT6 ID356
T6SS typei4b
Gene symbol-
Locus tagPAU_02269
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]2570966..2574466 [-]
Producthypothetical protein
NoteTssM
UniProt IDB6VKY4
KEGG IDpay:PAU_02269
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.70E-32, Aligned region: 172..356
ImcF-related_N [PF14331], Evalue: 2.70E-32, Aligned region: 613..683
Protein Sequence: 1166 a.a.     [Download]
>gi|253989749|ref|YP_003041105.1| hypothetical protein PAU_02269 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MKKLFYAIGWLSVMVILLLLSLIIAVAFSWPTIGGLILFLCLLLLLLLLRGAMALIPQITNKVSRINKFW
RQGNNRLEYLLYQHWWWGGRLQSWRRFRSWLQRNGSVPPWFLVVGELNSGKQSLLARSNVVPMTGRNLTS
FSENTFTCRWWFFRRAMYMVVSGRYTEGQSLYRQAWLRLIRWIAQVRNPAGVLVCLSAEQLLNSDNRALY
TMARNVRAQLEPLQIRLERRLPIWLILTHSEALPGFSRWCSQLSVEQRADLLGSFIDQHTDGNVTDVLDK
SILTIVDTLKMMRLKLLNQQRQQPQAEVLALPETVAQLKPALDYYLNALFERDHYLEHGLLRGVFFTAEH
QTELQQTEGVFSHRLLGEYLPNQIRRSDSVLLTGWRTLTKRALISVFSLMIVYGAGSALVNTWHGVTQLE
NIHETSPLERSYLRYQYVEQWLQQTVSYLLFYPVTYTLEQRMEQEYQQQVPVDVFNPESIATRLLMRFRE
AETPQKRLLVLHWSRFINIEQAMARGASLETLQHMPAYSASLLSGKDDPLRPDQRVALRLAQYRQGNAQQ
AFDQWRDTLQTLLEDSSDWQWLLADEQPTGTHSLTLADFWPLAEGDVAKVNARIRGIYTRAGERDIQATL
NELAQALDRPARFSPLQRSFCQQYQNQRQSEWLAFAQAMPQAEGLVRGKKNWQTLVLATGQFGSPYIVFL
SRLENDLSTVKQEDQQLWLQTQQRLWQLHGYIQKGSMMQRVSLGNISLRQRIMSWLGISPQISVRLDDNA
LTRYRDYRQAIQLNSQRELLSDMETESLVKNALSDGKGELNDNGLRTLFNRFALWRHETESKNAGVNETL
WRLYQGDAHLVLRYAFLSAASRLQTQWESKVIWPMEKLGGQTLLDGRELNARLYEYSNAFVRDTADYALD
IRPEGINRQEIEGVSFPFNDNFMFYINNLIQPNNMLSSTSDIRRRLQEKLALLESERELAAVQQEPEQEQ
SAEVVITSQPATANRGARVLPVGSSVTLSCNDGEQQLRSMNFNDSMTAHWNPASCGKVRIDVYFPSFTLS
KSYVGADSLLQFIRAFSHGELTLTAQTFPQRRNELGALGINDITVRYQIGGEKAVSSLYQQWQQRQQQQT
ALLEQRNRLDSQLLDLSEPTVAKGSLSTLPLQITTYWNELRKPKSE
 
Nucleotide Sequence: 3501 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c2574466-2570966 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGAAAAAGTTATTTTATGCCATTGGCTGGCTCAGCGTGATGGTTATCCTTTTGTTACTCAGTTTAATCA
TTGCTGTGGCGTTTTCATGGCCAACAATCGGTGGTCTGATATTATTTCTTTGTTTATTGCTGTTGTTATT
ATTGCTGCGTGGTGCGATGGCATTAATACCGCAGATAACGAATAAGGTGAGTCGGATAAATAAGTTCTGG
CGACAGGGAAATAATCGTCTGGAATATTTACTGTATCAGCATTGGTGGTGGGGAGGACGTTTACAAAGTT
GGCGTCGATTTCGTTCATGGTTACAACGTAACGGTTCTGTTCCTCCATGGTTTCTAGTGGTGGGAGAACT
CAATAGCGGCAAACAGTCATTGTTAGCACGCAGTAATGTGGTGCCTATGACAGGGAGAAATTTGACATCG
TTTTCGGAGAATACCTTTACTTGCCGTTGGTGGTTTTTCCGTCGGGCGATGTACATGGTAGTTTCTGGTC
GTTATACCGAGGGCCAATCCTTGTACCGGCAAGCGTGGTTGCGTCTGATACGTTGGATCGCACAGGTGCG
TAACCCTGCGGGTGTACTCGTTTGTCTGTCGGCAGAGCAGTTGCTAAACAGTGACAATAGAGCGCTCTAT
ACCATGGCGCGTAATGTACGTGCGCAGTTGGAACCGTTGCAGATACGTTTGGAACGTCGTTTACCAATCT
GGTTAATTCTGACACACAGTGAAGCATTGCCGGGGTTCAGCCGTTGGTGTTCGCAATTGTCGGTAGAGCA
GCGTGCTGACTTACTGGGTAGTTTTATTGATCAACATACAGATGGCAATGTCACTGATGTGCTGGATAAG
AGTATACTCACGATTGTTGATACTCTGAAAATGATGCGCCTTAAATTGCTCAATCAGCAACGGCAGCAAC
CACAAGCAGAAGTGTTGGCGTTACCGGAAACTGTTGCCCAATTGAAACCCGCATTGGACTATTACCTAAA
CGCATTATTCGAGCGTGATCATTATCTGGAACATGGTCTGTTACGCGGCGTATTTTTTACTGCGGAACAT
CAAACAGAATTGCAGCAAACCGAAGGCGTTTTTAGTCACCGTTTGTTGGGAGAATATCTGCCTAACCAGA
TTCGACGTAGTGATTCTGTTTTGCTAACCGGTTGGCGAACATTGACCAAACGTGCGTTGATTAGTGTGTT
TAGCTTGATGATTGTATACGGTGCAGGTAGCGCATTGGTTAATACCTGGCATGGCGTCACGCAACTTGAG
AATATCCATGAAACCAGTCCACTTGAGCGGAGCTACTTGCGCTATCAATATGTTGAGCAATGGTTACAGC
AAACAGTGTCATACCTGCTTTTTTATCCTGTCACCTATACGCTGGAACAGCGTATGGAGCAGGAATACCA
GCAGCAGGTTCCAGTTGATGTGTTCAATCCTGAGTCGATAGCCACACGTTTGCTAATGCGTTTCAGGGAG
GCTGAAACACCGCAAAAACGACTGTTGGTTTTACATTGGTCGCGCTTTATCAATATCGAGCAGGCAATGG
CGCGTGGTGCTTCACTGGAAACTTTACAACACATGCCTGCTTATTCTGCCTCACTATTAAGCGGTAAAGA
TGATCCTCTACGGCCAGATCAGCGGGTAGCATTGCGTTTAGCACAATATCGTCAAGGCAACGCACAGCAA
GCCTTCGATCAATGGCGGGATACATTGCAGACATTATTGGAAGATTCCAGTGATTGGCAGTGGCTTTTGG
CGGATGAACAACCGACTGGAACGCATTCGCTAACGTTGGCGGATTTCTGGCCGCTGGCGGAAGGTGATGT
TGCTAAGGTTAACGCGCGTATTCGTGGCATTTATACTCGCGCAGGTGAGCGGGATATTCAGGCTACCTTG
AATGAGTTGGCACAGGCTCTTGACCGACCGGCACGCTTTTCTCCTTTGCAGCGCTCATTCTGTCAACAAT
ATCAGAACCAGCGTCAGTCAGAGTGGTTGGCATTTGCTCAAGCAATGCCACAAGCGGAAGGATTAGTACG
TGGTAAGAAAAACTGGCAAACGTTGGTATTAGCAACCGGCCAGTTTGGCAGTCCTTATATTGTTTTTCTG
TCACGACTGGAGAATGACCTGTCTACGGTGAAGCAGGAAGATCAGCAGCTTTGGTTACAGACGCAACAGC
GTTTATGGCAACTGCATGGCTATATACAAAAAGGCAGCATGATGCAGCGTGTCTCGCTGGGAAATATTTC
CTTGCGCCAACGCATAATGTCATGGCTTGGCATTTCACCGCAGATCTCTGTGCGGTTGGATGACAATGCA
TTAACGCGCTATCGCGATTACCGGCAGGCCATACAGTTGAATAGTCAACGTGAATTGCTCAGTGACATGG
AAACGGAATCGTTAGTCAAAAATGCGTTGAGTGATGGGAAAGGGGAACTAAATGATAACGGTTTACGTAC
ATTGTTTAATCGCTTCGCATTGTGGCGTCATGAAACGGAAAGCAAGAATGCCGGAGTAAATGAAACCTTG
TGGCGGCTCTATCAGGGTGATGCTCATTTGGTACTGCGTTATGCCTTCTTAAGTGCTGCCAGCCGCTTGC
AAACACAGTGGGAAAGTAAAGTGATCTGGCCGATGGAAAAATTAGGCGGACAGACGCTGTTGGATGGTCG
GGAATTGAATGCACGGTTGTATGAATACAGCAATGCATTTGTACGGGATACGGCAGATTATGCGCTGGAT
ATTCGTCCTGAAGGCATTAATCGCCAAGAAATTGAAGGTGTGTCCTTTCCGTTTAACGACAATTTTATGT
TCTATATCAATAATTTGATTCAACCGAATAACATGCTGTCATCTACATCTGATATTCGTCGCCGTTTGCA
AGAGAAGCTCGCTTTGTTGGAAAGCGAACGTGAATTGGCTGCGGTACAGCAGGAACCGGAACAAGAGCAA
TCAGCAGAAGTGGTGATTACCAGTCAGCCTGCGACGGCTAACCGGGGAGCGAGGGTGTTACCGGTTGGTA
GTTCAGTGACGCTAAGTTGTAATGATGGTGAGCAACAACTCAGAAGTATGAATTTCAATGACAGTATGAC
TGCGCACTGGAATCCGGCCTCATGCGGCAAGGTACGGATTGATGTGTATTTCCCCAGTTTTACGCTAAGC
AAAAGCTATGTTGGTGCTGATAGCTTGCTGCAATTTATACGCGCTTTTTCTCATGGCGAACTGACATTGA
CAGCGCAAACATTCCCGCAGCGGCGCAATGAATTAGGCGCTTTGGGTATCAATGACATCACAGTGCGATA
TCAGATCGGTGGAGAGAAAGCGGTTTCTTCATTGTATCAACAGTGGCAACAACGTCAGCAGCAACAAACC
GCACTATTGGAACAACGCAACCGACTGGATAGTCAGTTGTTGGATTTAAGTGAGCCGACAGTGGCGAAAG
GCTCTCTTTCTACATTGCCGTTACAAATCACGACATATTGGAACGAATTGAGGAAACCTAAAAGTGAGTA
A
 Primer design