SecReT6
Protein ID: 253990515
SecReT6 ID357
T6SS typei2
Gene symbol-
Locus tagPAU_03041
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]3578063..3581410 [-]
Producthypothetical protein
NoteTssM
UniProt IDB6VMZ8
KEGG IDpay:PAU_03041
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.70E-74, Aligned region: 394..712
IcmF-related [PF06761], Evalue: 4.70E-74, Aligned region: 777..800
DUF1215 [PF06744], Evalue: 1.40E-36, Aligned region: 835..955
Protein Sequence: 1115 a.a.     [Download]
>gi|253990515|ref|YP_003041871.1| hypothetical protein PAU_03041 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MVNTLILLVGTITLLVSLAGLGWWFWGEHQTTDAETFNHLLRVCGIAWGFMVVVSMLGFITVTLFVKSKV
TDAKPDTRPLLPVSKPYNYSELGARLHRRYGRFWWFKVRILLVMGEGEQVEAIAPGLTAGHWLEGHRTLL
VYGGSVQSEPDAAQLTALRRLRRFRPLNGVVWALTETQSAQPVLMDKALRMLQKQAQQLRWQAPVYLWQV
CHSVWSQEDRVTQPVGCFFPERTTPEAVAAQLQRLIDPMRRQGMQQLLAKNAHDFLYRLSSTLEKQGMAH
WRDVLTPVLQEYADVVLLRGLMFSLPVRVNQDGAPQSWLPDPVWQGVLSDCRQAPGRRLGWVQKRQVYHG
LMALALLWGAGMVLSFFSNRDQIMVVQAAVADLKTHPAASGAELMALNTLRNEVGRLQSRVEHGAPWYQR
FGLNQNETLLARVMPDYTEVNNRLIRDKAAAVLQAKLRALVNLPPNSPLWANRATAGHDLLKAYLMMARP
EKAEGAFLTRILSENEPARAGIASGIWLSVAPDLWDFYAHNLAAHPAWKITPDTDLIRQVRQKLLTQLSR
HNADATLYQQMLQSVAKDYADLTLRQMTGDTEAARLFTTDKVVPGMFTRQAWEGQIQTAIDKAVASRRDA
IDWVLSDRHQTVPAAVSPAELKARLTERYFTDFAGAWQTFLNSLRWNTAQSLSAVVDQLTLMADARQSPL
IALMNTVAYQGQTGQQGATLSDSLVKSAKALWNKKTPPGIVPQAAGTPGPMAATFGPLRALMGDSQTDGG
MKADSSLNLQTFLTRVTQVRLTLQQMNTSDDPPAMANTLARAVFTGKSTALTETQGYGRLIAASLGEQWQ
GLGQTLFVQPLTQAWQGVLNPAAANLNTQWQTAIVASWNRAFAGRYPFAGGESEVSLPMLGQFIRSDSGR
IEQFLNRQLGGILHKAGNRWRVDEVNSQGLRINPRFLQAVNQLSQLSDVLFADGSQGLRFELRARAVRDV
AETDLTIDGQPLRYFNQMESWQRFRWPGETYRPGVMLSWMSVNAGSRLFGDYQGNWGLIRWLAQAKVERL
DESRYRLTFMAPDGLPLRWILRTEMGSGPLALLKLRGFQLPKAIFEVAPGQERPAETTDEDWAAE
 
Nucleotide Sequence: 3348 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c3581410-3578063 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
GTGGTGAATACGCTCATCTTACTGGTGGGAACCATTACCCTGCTGGTGTCGTTAGCGGGTCTGGGATGGT
GGTTTTGGGGAGAGCACCAAACCACGGATGCCGAGACGTTTAATCATTTGTTACGGGTTTGTGGAATAGC
CTGGGGGTTTATGGTGGTGGTGAGTATGCTGGGTTTTATCACGGTCACATTGTTTGTCAAAAGCAAAGTG
ACTGATGCGAAGCCAGATACCCGGCCACTTTTGCCGGTCAGCAAACCGTATAATTACAGTGAATTAGGTG
CCCGCCTGCACCGCCGTTACGGTCGGTTCTGGTGGTTCAAAGTGCGTATTTTGCTGGTGATGGGCGAGGG
GGAACAGGTGGAGGCGATTGCGCCGGGGCTGACTGCCGGACACTGGCTGGAGGGCCATCGCACGCTGTTG
GTGTACGGCGGTAGTGTGCAGAGTGAGCCGGATGCTGCCCAGTTGACGGCCCTGCGTCGGTTGCGCCGTT
TCCGGCCACTGAATGGGGTGGTTTGGGCGCTGACCGAAACCCAGAGTGCCCAGCCGGTCCTGATGGACAA
GGCGCTGCGGATGTTACAGAAACAGGCCCAGCAGTTACGCTGGCAGGCACCGGTTTATCTGTGGCAGGTG
TGTCACAGTGTCTGGTCGCAGGAAGACCGTGTCACTCAGCCGGTGGGCTGCTTTTTCCCGGAACGCACGA
CACCGGAAGCGGTGGCGGCACAATTACAGCGGCTGATTGACCCGATGCGCCGGCAGGGCATGCAGCAACT
GCTGGCAAAAAATGCCCATGATTTTCTGTATCGCCTGTCGTCTACTTTGGAGAAGCAGGGAATGGCTCAC
TGGCGTGATGTGCTGACGCCGGTATTGCAGGAATATGCGGATGTTGTGTTGTTGCGGGGGCTGATGTTCA
GTCTGCCGGTCAGAGTCAATCAAGATGGCGCGCCCCAGAGCTGGCTGCCGGACCCGGTATGGCAGGGGGT
ACTCAGTGACTGCCGACAGGCCCCCGGCAGACGGCTGGGATGGGTTCAAAAACGGCAGGTTTATCACGGC
CTGATGGCGTTGGCGTTGTTGTGGGGGGCGGGTATGGTGCTGTCATTTTTCAGCAACCGCGACCAGATAA
TGGTCGTCCAGGCGGCGGTGGCGGACCTGAAAACGCACCCGGCCGCATCCGGGGCTGAACTGATGGCGTT
AAACACGCTGCGCAATGAAGTGGGCCGGTTGCAGTCCCGGGTGGAACACGGGGCGCCCTGGTATCAGCGT
TTTGGTCTGAATCAGAATGAGACGCTGCTGGCGAGGGTGATGCCGGATTACACCGAAGTGAATAACCGGC
TGATACGGGATAAAGCCGCGGCGGTGTTGCAGGCGAAACTGAGAGCGCTGGTGAATTTACCACCGAACAG
TCCGCTGTGGGCGAATCGGGCGACAGCCGGTCATGACCTGTTAAAGGCCTACCTGATGATGGCCCGTCCG
GAGAAAGCGGAGGGGGCATTTTTAACCCGGATACTCAGTGAAAATGAGCCGGCCCGGGCCGGGATTGCGT
CGGGTATCTGGCTGAGTGTGGCGCCGGATTTATGGGATTTTTACGCGCACAATCTGGCGGCCCATCCGGC
ATGGAAAATCACCCCGGATACGGATTTAATCCGGCAGGTGCGTCAGAAACTGTTGACCCAGTTAAGCCGT
CACAATGCGGATGCCACGCTCTACCAGCAGATGCTGCAATCGGTGGCGAAGGATTATGCGGATTTGACGC
TGAGGCAGATGACCGGCGACACGGAAGCGGCGCGGTTGTTTACCACGGATAAAGTGGTGCCGGGGATGTT
TACCCGTCAGGCATGGGAAGGGCAGATACAGACAGCGATTGATAAGGCGGTGGCTTCGCGACGCGACGCG
ATTGACTGGGTGCTGAGTGACCGCCATCAGACCGTCCCGGCGGCGGTGTCACCGGCGGAGCTGAAAGCCC
GGCTGACCGAACGTTACTTTACGGATTTTGCCGGGGCGTGGCAGACGTTTCTGAACAGCCTGCGCTGGAA
TACAGCCCAGAGTCTGTCGGCGGTGGTCGACCAGTTAACCCTGATGGCGGATGCGCGTCAGTCCCCGCTG
ATAGCGTTGATGAACACGGTGGCGTATCAGGGGCAAACGGGTCAGCAAGGCGCCACGTTATCGGATTCAC
TGGTGAAATCGGCGAAGGCGCTGTGGAATAAAAAAACGCCCCCGGGGATTGTCCCGCAGGCGGCAGGCAC
GCCGGGACCAATGGCGGCGACCTTTGGGCCACTGCGGGCATTGATGGGAGACAGTCAGACGGACGGGGGA
ATGAAGGCGGATAGCAGCCTGAATTTACAGACCTTTCTGACGCGGGTCACACAGGTGCGACTGACACTGC
AACAGATGAACACCAGTGATGACCCGCCGGCCATGGCGAATACGCTGGCCCGGGCGGTATTTACCGGGAA
AAGCACGGCGTTGACAGAGACGCAGGGTTATGGGCGTCTGATAGCGGCCAGTCTGGGGGAACAATGGCAG
GGGTTGGGTCAGACGCTGTTCGTGCAGCCGTTAACGCAGGCGTGGCAGGGGGTACTGAACCCGGCGGCGG
CGAATCTGAATACGCAGTGGCAGACGGCGATAGTGGCCAGCTGGAACAGGGCGTTTGCGGGGCGTTATCC
GTTTGCTGGCGGGGAGAGTGAAGTGTCGTTACCGATGCTGGGGCAGTTTATCCGGTCGGATTCGGGGCGG
ATAGAGCAGTTTCTGAACCGTCAGCTAGGCGGGATACTGCATAAAGCGGGCAACCGTTGGAGGGTGGATG
AGGTGAACAGTCAGGGGTTGCGGATTAACCCGCGGTTTTTGCAGGCGGTGAATCAGCTGAGTCAGTTATC
GGATGTGCTGTTTGCGGATGGCAGTCAGGGGTTACGGTTTGAGCTGCGGGCGAGAGCGGTGCGGGATGTG
GCGGAAACTGACCTGACGATAGACGGCCAGCCGCTGCGTTACTTTAACCAGATGGAAAGCTGGCAGCGTT
TTCGCTGGCCGGGGGAGACTTACCGACCGGGGGTGATGCTGAGCTGGATGAGTGTGAATGCGGGGTCCCG
TTTATTTGGGGATTATCAGGGGAACTGGGGGCTAATTCGCTGGCTGGCGCAGGCGAAAGTGGAGAGGCTG
GATGAGAGTCGTTATCGGTTAACGTTTATGGCCCCGGATGGTTTGCCGCTGAGGTGGATTTTACGCACGG
AAATGGGGAGTGGCCCGCTGGCGTTGCTGAAACTGCGGGGCTTTCAGTTGCCGAAGGCGATTTTTGAGGT
GGCACCGGGTCAAGAGAGGCCAGCCGAGACGACTGATGAGGACTGGGCGGCGGAATAA
 Primer design