SecReT6
Protein ID: 253991258
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03785
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4391166..4391696 [+]
Producthypothetical protein
NoteTssJ
UniProt IDB6VL99
KEGG IDpay:PAU_03785
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 4.90E-23, Aligned region: 21..139
Protein Sequence: 176 a.a.     [Download]
>gi|253991258|ref|YP_003042614.1| hypothetical protein PAU_03785 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MLLLPRHKSHCFFAFILLSILLSVSCSANKAEENIPYTIKFQTHGDINNHAPLKLNILLLSDPDKFNQAD
IGSLQKDTHSTLNDTVLCQKSIFLLPKKEQQNDISITINTPSTEKYIAIWAEYQNISDKQWRIAIPLSSF
LTTPSLSVLNPFSSSELYQLITVTSHGLQIASASDQ
 
Nucleotide Sequence: 531 bp     [Download]
>gi|253987483|ref|NC_012962.1|:4391166-4391696 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGTTGCTTTTACCTCGTCATAAAAGTCATTGTTTCTTTGCCTTTATTCTGCTGAGCATACTTCTAAGTG
TTAGTTGTTCTGCAAATAAAGCGGAAGAAAATATTCCATACACAATTAAATTCCAGACACATGGAGATAT
TAACAACCACGCTCCATTAAAATTAAATATATTATTGTTAAGTGATCCAGATAAATTTAATCAGGCTGAT
ATCGGGTCTTTACAAAAAGATACCCATTCAACGCTGAATGATACTGTACTTTGTCAAAAATCCATCTTCT
TACTGCCGAAAAAAGAACAACAAAATGATATCAGTATTACCATTAATACACCGTCAACGGAGAAATATAT
TGCGATTTGGGCCGAGTATCAGAATATTAGTGACAAACAATGGCGGATCGCTATTCCTCTATCATCGTTT
CTAACCACACCTTCTTTATCGGTTTTGAATCCTTTTTCATCTTCTGAGCTTTATCAGTTGATTACCGTTA
CTTCTCACGGATTACAGATAGCATCTGCGTCCGATCAATGA
 Primer design