SecReT6
Protein ID: 253991259
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03786
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4391722..4393071 [+]
Producthypothetical protein
NoteTssK
UniProt IDB6VLA0
KEGG IDpay:PAU_03786
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.40E-122, Aligned region: 19..438
Protein Sequence: 449 a.a.     [Download]
>gi|253991259|ref|YP_003042615.1| hypothetical protein PAU_03786 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MKNAHKVLWMEGMFLRPHHFQQADEYVDARLRQWGALQRAYNWGFSSLKIDESQLTLGKISLLAASGIMP
DGTSFEFTETNEAPPALAISTSLRSQIITLAIPAYLAGRESVSFDDAPDSLARYQAFEKEVNDINSLALS
STTLHCGRLRLRLLPENELNSEWIAMGVLRVLEKNQDGIVILDTGYIPPLLNCWTSPLLQNITHDLYGLL
LQRSRQLSRHLQCNGSCTSDLLRLALLNRFSAQLQHIMHLPQQAPEMLFLSWISYALEMSSFQAPYTLEG
ELPRYNHLDIGGCFTRLCTLLQRSLSIVLEEHVVSLPLTKRLPGLSVATLPEQMNLDDYHFVLVVKSEME
HDSFMTHFPAQIKIAPADRIRDLVRLQLPGIALRHLVQIPRQLPYQNGHCYFKLELNSKTEQSLGKSGVF
AFYIAGEFPGLKMAFWALKRLSDEEEMNL
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|253987483|ref|NC_012962.1|:4391722-4393071 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGAAAAATGCACACAAAGTTCTCTGGATGGAAGGCATGTTTTTACGACCTCACCATTTTCAACAAGCAG
ATGAGTATGTAGATGCACGCTTACGTCAATGGGGAGCTTTGCAACGAGCCTACAATTGGGGGTTTTCATC
ATTAAAAATTGATGAGAGCCAGCTTACTCTGGGAAAAATCTCACTGCTGGCGGCCAGCGGTATTATGCCT
GATGGCACCAGTTTTGAATTTACTGAAACCAATGAGGCCCCACCAGCATTAGCAATCAGCACTTCACTAC
GTTCACAAATTATCACCTTAGCTATACCGGCATATCTGGCCGGACGTGAATCCGTCAGTTTCGATGATGC
ACCCGATTCTTTGGCGCGTTATCAAGCATTTGAAAAAGAGGTCAATGACATCAATTCGCTGGCACTCAGT
AGTACGACCTTACATTGCGGGAGATTACGCCTGCGTCTGCTACCAGAAAATGAGTTGAATAGTGAATGGA
TTGCCATGGGAGTACTGCGGGTTTTAGAAAAAAATCAGGATGGTATTGTCATTCTTGATACAGGATATAT
TCCACCGTTGCTTAACTGTTGGACAAGCCCGTTATTACAGAACATAACTCATGATCTGTACGGTCTATTA
TTACAACGCAGTCGACAGCTTAGCCGTCATCTGCAATGTAATGGTTCTTGCACCAGTGATTTATTACGAC
TGGCGCTATTAAACCGTTTTAGCGCTCAGCTGCAACACATCATGCATCTGCCTCAACAGGCACCCGAAAT
GCTTTTCCTTAGCTGGATCAGCTATGCACTGGAAATGAGTTCTTTTCAAGCGCCTTATACATTGGAGGGA
GAATTACCCCGCTACAACCATCTGGATATCGGTGGTTGCTTCACCCGCCTCTGTACTTTACTGCAACGCA
GTTTGTCGATTGTGCTGGAAGAGCATGTTGTATCACTGCCCCTGACCAAACGCCTACCAGGACTGAGCGT
CGCAACACTGCCAGAACAGATGAATCTGGATGATTACCACTTCGTCTTAGTCGTGAAGTCTGAAATGGAG
CATGACTCTTTTATGACTCACTTTCCGGCCCAAATCAAAATCGCGCCAGCTGATCGCATACGCGATCTGG
TGCGCCTGCAATTGCCAGGTATTGCCCTGCGCCACTTGGTACAGATCCCCAGACAACTTCCCTATCAGAA
TGGGCACTGCTATTTCAAATTGGAATTAAACAGTAAAACTGAACAGTCGCTGGGAAAATCCGGGGTGTTT
GCCTTCTATATTGCGGGTGAGTTTCCTGGTCTGAAAATGGCATTTTGGGCGCTTAAACGTCTGTCTGATG
AGGAGGAAATGAACCTATGA
 Primer design