SecReT6
Protein ID: 253991261
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03788
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4394248..4397805 [+]
Producthypothetical protein
NoteTssM
UniProt IDB6VLA2
KEGG IDpay:PAU_03788
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 7.90E-78, Aligned region: 200..464
IcmF-related [PF06761], Evalue: 2.20E-72, Aligned region: 298..321
IcmF-related [PF06761], Evalue: 2.20E-72, Aligned region: 514..817
DUF1215 [PF06744], Evalue: 1.90E-27, Aligned region: 558..597
DUF1215 [PF06744], Evalue: 1.90E-27, Aligned region: 632..659
DUF1215 [PF06744], Evalue: 1.90E-27, Aligned region: 925..1048
Protein Sequence: 1185 a.a.     [Download]
>gi|253991261|ref|YP_003042617.1| hypothetical protein PAU_03788 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MLRAFIAIITNRLFWGALIVAALCLLIWIIGPFIAIGDHHPLATEVQRQIAITALISLWLLLRLLPFLYQ
VWVNARLRRRLHHVSNVTPTTRNASQSLADNFKQAASLIKRGLRLNGEQLTTRLGKFYLYRLPWYLVLGT
KGCGKDKSLLNSGLDFYHTTYPSQFAFPETNAESHCSWYFTLQGVILSPAGEYLKEGNPLWQALLKLLKR
YRPRQPINAVILTISVQDLLQQDNDAQYHQALLLRKRLMDLRLQLKIDFPVYVMITKADLLPGFSSYFNG
FYGEELDQVWGFTFPWEQALHSHNDLQQMLDEQYDRLQQRLDAALADTLITQQDITQREQSFAFPQAFAT
LRPVLMRYLSIIFATSGFDRPWLPHGLYFTSANQKHGEFQHSNGTTQDNLFDYSYALSSVTNSDGETTHR
TARSYFLRQLFQKIILAESGLAGINRMYELRRRFMLLTGCGLLLSLMAGICLLLLTSYHNNKSYLAQITA
RLPLLEQQGRALNKPSARDLPHLIQYLTQLQSLTTNQQINPDSPPLVYGMGLYQGPQLNSASYPVYQHAL
KNLLLPLVTQQVESILRQQADSNNSESTYEALKAYQMLFQTQHYDGKFLTAWLMLNLSHIPSGEKLNEAQ
RQALQEHLYQLLNHSQPSWSQHKDQQLIQEAIKNIMRSTFSQRVYTSIKKRLINSGRFKSVNLLDLAGSQ
AELVLKRKSDLPDTAAIPGFFTPDGYWHGLVAQVDDTVKTLHDTDRWVLNIPPQVQEGCDAACRVRQLYM
DDFMLEWDTFLNDIALIPTSSLNQRINNVRILSGAHSPLRNLLIGISHIVALSPPEDHGKLTQLGQQLND
EASRKLQNLFPAVRTTPAPPSPEQIVRSHYRDLLDLARPQGNNSDAIAFDDLFKKLGDLYRYLTALQENG
EATASSSGTILTQLQADAGRLPAPFRSIIMDMTQGAKGDTQQQAVSRIHQLANAQLSDFCREAIAGRYPL
SRHSKRDMTPDDMAHMFAPNQGLMDRFFNQYLVDKVNTQGNEWRFFPWALGSTKPEDQSLLKTFRQAQFV
RDAFFGTASSQPSFSLTLQPLRMDNDILTLSLTLNDQNASYSHGPLTSWYFTWPGSNNAGKAKLTMLLAN
GKTKSLETSGPWALNRLIDAGKWFQEDSMHYRITFNLAGHQATLILTPDSIHNPFVLPEFTCIKP
 
Nucleotide Sequence: 3558 bp     [Download]
>gi|253987483|ref|NC_012962.1|:4394248-4397805 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGTTAAGAGCATTTATCGCCATCATCACTAATCGCCTGTTTTGGGGGGCGCTGATCGTTGCCGCATTGT
GTCTGCTTATTTGGATCATCGGGCCATTTATCGCCATCGGTGATCACCATCCACTAGCAACCGAAGTCCA
ACGCCAAATAGCTATCACCGCCCTGATTTCGCTGTGGTTATTGCTACGGCTGTTGCCTTTTCTCTATCAG
GTATGGGTAAATGCTCGTTTGCGCCGCCGTTTACACCATGTCAGCAATGTCACGCCAACAACCCGAAACG
CCTCTCAATCCCTCGCTGACAATTTTAAACAAGCGGCGTCCCTGATCAAACGAGGGTTACGTCTGAATGG
CGAACAACTCACCACACGTCTGGGCAAATTCTATCTCTATCGCCTGCCCTGGTATCTGGTTTTGGGTACC
AAAGGATGTGGTAAAGATAAATCTCTACTGAATTCAGGGTTAGACTTCTACCACACAACCTATCCAAGCC
AGTTCGCTTTTCCTGAAACCAATGCCGAATCGCACTGTTCATGGTATTTCACCCTGCAAGGCGTCATTCT
TAGCCCTGCCGGAGAGTACCTTAAGGAAGGCAACCCTTTGTGGCAGGCCTTATTAAAACTGCTAAAACGT
TATCGTCCACGTCAGCCAATCAACGCCGTTATTCTGACAATCAGCGTACAAGATCTGCTGCAACAAGATA
ATGACGCGCAATATCATCAGGCGTTATTACTGCGTAAGAGACTGATGGATTTACGTTTACAACTGAAAAT
TGACTTTCCGGTCTACGTGATGATCACCAAAGCTGACTTGCTCCCGGGGTTCAGTAGCTACTTCAACGGT
TTTTATGGCGAAGAATTGGATCAGGTCTGGGGTTTCACCTTTCCCTGGGAACAAGCATTGCATTCCCATA
ACGATTTACAACAGATGCTGGATGAGCAATATGACCGTTTGCAGCAACGTCTGGACGCTGCACTGGCGGA
TACCTTAATAACCCAACAGGATATCACTCAACGGGAACAAAGCTTTGCCTTCCCACAGGCATTTGCCACC
CTACGCCCAGTCTTGATGCGTTATCTGAGTATTATTTTTGCCACTTCTGGCTTTGATCGCCCATGGTTAC
CACATGGTCTCTATTTCACCAGCGCTAACCAAAAGCATGGGGAATTTCAGCACAGTAATGGAACTACGCA
AGATAATCTGTTCGATTACAGTTATGCGCTTTCCTCTGTTACCAATAGCGATGGCGAAACAACTCACCGG
ACTGCCCGCAGTTACTTTCTGAGACAATTATTCCAAAAAATCATTTTGGCTGAGAGTGGGCTGGCAGGGA
TCAACCGCATGTACGAATTGCGCCGACGCTTCATGCTACTGACCGGATGTGGACTATTACTCAGTCTAAT
GGCTGGGATCTGCTTACTACTACTGACAAGTTACCACAATAACAAGAGTTATCTGGCACAAATTACAGCC
CGACTTCCTCTACTAGAACAACAGGGCCGGGCGCTGAACAAACCATCAGCTCGCGATCTACCACACTTGA
TCCAGTATTTGACACAGCTACAGTCACTGACAACTAATCAGCAAATTAATCCAGACAGTCCGCCACTTGT
TTACGGTATGGGATTATATCAAGGCCCGCAACTGAACAGTGCCAGCTATCCCGTTTATCAGCATGCGTTA
AAGAATTTATTGCTGCCTCTGGTGACACAGCAAGTCGAGAGTATTCTGCGTCAGCAAGCTGATAGCAATA
ACAGTGAATCAACTTACGAAGCACTGAAAGCCTACCAAATGCTATTTCAGACACAACATTACGATGGCAA
ATTCCTTACCGCTTGGCTGATGTTGAATCTGTCTCATATTCCCAGTGGTGAAAAGTTGAATGAGGCACAA
CGTCAAGCACTTCAGGAACATCTTTATCAGCTACTGAATCACAGTCAACCTTCCTGGTCTCAACACAAGG
ACCAACAGCTGATACAGGAAGCGATAAAAAATATCATGCGTTCTACGTTTTCCCAGCGGGTTTATACCAG
CATAAAAAAAAGGCTGATCAATAGCGGACGTTTCAAATCCGTCAATCTGCTTGATTTGGCGGGTTCTCAG
GCTGAGTTGGTATTAAAACGTAAAAGCGACCTGCCAGATACTGCGGCGATCCCCGGCTTTTTTACACCAG
ACGGATATTGGCACGGTCTGGTTGCACAGGTCGATGATACGGTAAAGACACTTCATGATACTGATCGCTG
GGTACTCAATATTCCGCCACAGGTACAGGAAGGGTGCGACGCTGCCTGCCGAGTACGCCAGCTTTATATG
GATGACTTTATGTTGGAGTGGGATACATTTCTCAATGATATCGCTCTAATCCCGACAAGTAGCCTCAACC
AGCGTATTAATAATGTGCGTATTCTCTCTGGCGCCCACTCGCCCCTGCGTAATCTGCTAATTGGCATCAG
CCACATTGTTGCATTATCTCCACCCGAAGATCATGGCAAACTCACGCAGCTGGGCCAGCAACTGAACGAT
GAAGCCTCTCGAAAATTACAAAATCTGTTTCCGGCGGTCAGAACTACCCCAGCGCCACCTTCACCAGAAC
AGATTGTTAGAAGTCACTATCGTGATCTGCTCGATCTGGCACGTCCACAGGGAAATAACAGTGACGCGAT
CGCCTTTGATGATCTGTTCAAGAAACTGGGGGACTTGTATCGCTACCTTACCGCCTTACAGGAAAATGGT
GAAGCGACAGCCTCCTCTTCGGGTACCATACTGACACAATTACAGGCTGATGCCGGCCGCCTGCCTGCTC
CGTTCCGCAGCATTATCATGGACATGACGCAGGGGGCCAAAGGCGACACGCAACAACAGGCAGTTTCGCG
CATACACCAATTGGCCAATGCTCAGTTAAGTGACTTCTGCCGTGAGGCCATTGCCGGACGTTATCCGCTT
TCCCGCCACAGCAAACGTGATATGACTCCCGACGATATGGCACATATGTTTGCGCCGAATCAGGGGTTAA
TGGATCGCTTTTTTAATCAATATCTGGTGGATAAGGTCAACACCCAAGGCAACGAATGGCGCTTTTTCCC
CTGGGCACTAGGCAGTACCAAGCCAGAAGATCAGTCACTGCTAAAAACATTCCGGCAAGCGCAGTTTGTC
CGTGATGCATTTTTTGGTACCGCCTCTTCACAACCCTCTTTCTCCCTTACCTTGCAACCTCTGCGCATGG
ATAACGACATCCTTACCCTGTCGCTGACACTCAACGATCAAAATGCCAGTTACAGCCACGGTCCGCTGAC
ATCCTGGTACTTCACCTGGCCCGGTAGCAACAATGCCGGTAAAGCCAAACTGACCATGCTGTTGGCTAAT
GGCAAAACCAAATCACTGGAAACTTCAGGGCCTTGGGCATTAAACAGGCTGATTGATGCAGGAAAATGGT
TTCAGGAGGACAGCATGCATTATCGAATCACTTTCAATCTGGCAGGGCACCAAGCCACGCTGATACTCAC
CCCCGATAGCATACACAACCCGTTTGTTCTGCCGGAATTTACTTGTATCAAACCATAA
 Primer design

Protein ID: 253991293
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03820
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4437011..4440307 [-]
Producthypothetical protein
NoteTssM
UniProt IDB6VLD4
KEGG IDpay:PAU_03820
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 5.30E-73, Aligned region: 399..711
DUF1215 [PF06744], Evalue: 2.50E-35, Aligned region: 834..954
ImcF-related_N [PF14331], Evalue: 0.00026, Aligned region: 156..209
ImcF-related_N [PF14331], Evalue: 0.00026, Aligned region: 663..677
Protein Sequence: 1098 a.a.     [Download]
>gi|253991293|ref|YP_003042649.1| hypothetical protein PAU_03820 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MFKAFIARNLGVGLVTNLIALVLGGLLYFWGARLGLDTPAVKIIVWIVSMVGVVWLLNLFRDYKQCVPVP
DIAAKVSVASAESSEGPFYFHRLQDHVRHRYGRFWRRKVRILMVMGQREQVEAIAPGLTKQHWLEGESNL
LLWGGSLQVAPDVAQLKALRKLRRRCPLDGVVWVMTEEQLSQRAEIDTALRMLEKQGQQLGWQAPVYVWH
VQCSLWDQRDRPTQTVGCFLPSESPPPLLTESLNTLPSQLAARGMAQALANIRHDFLLRLAQSLREGGVT
RLVRQLTPLLNRPSVWMAGVMFSLPLAAQPGMTEHGWLVDASWNGVLEDVRHVRGNAVGFPWEKSAQWGL
IVLAALWGMGSVTSFFANRHQITLSRERVSQVSHRQHSLSDRLLSQHALQLELDRLQHRAEAGAPWYSRF
GLNQNGVLLRTLWPVYQRNNAPLIRDAAARVLHQRLADWVNLPPGSPQRCQQMKAAYAQLKAYLMMARPE
KADAAFMSRVLMESWPHRAGVRDGLWQNTGASLLRFYAQHLPQHPVWKIIADAGLVSEVRQILLNQQGQR
NAEATLYQHLLQQVAHSYGDLSLAQMTGATDASRLFSTNKVVPGMFTRQAWEGQVQQAIAAVVASRREAM
DWVLSDGGQPMAEAVSPGVLQARLRARYFRDFAGAWLNFLNSLRWNRVHNLSDTLDQLTLMADVRQSPLI
ALMNTLAYQGETGQPDEGLSDSLVNTARTLFQKTPPLVIDQNRGPQSPMENTFGPLLSLMGKTPGQALMT
ADSTLSLQTFLTRVTRVRLTLQQIANTDDPQERMQALAQTVFQGKRVDLTDTQSYGSLIAASLGSDWSGF
GQTVFVQPLTQAWQTVLQPSAASINAQWQASVVSDWQAAFNGRYPFVDEQNEASLPVLGQFIAADTGRIE
QFLQRELGGVLHKEGHYWVADKVGSQGLLINPAFLTAINQLSAIADVLFMNGRQGLRFELRAKPVRDVAE
TDLTIDGQRLRYFNQMESWQRLRWPGESDNPGVVLTWTSVDTGARVFGDYPGEWGLLRWLEQAKVKALDG
GRYRLTFNAPDGLPLSWDLRTEQGKGPLVLLGLKGFRLPAQIFSEKEE
 
Nucleotide Sequence: 3297 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c4440307-4437011 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGTTTAAAGCTTTTATTGCCCGTAATCTGGGCGTGGGGTTGGTCACCAACCTGATCGCACTGGTATTGG
GGGGATTGTTATATTTTTGGGGGGCGCGATTAGGGTTGGACACGCCGGCGGTCAAAATAATCGTCTGGAT
TGTCAGTATGGTCGGCGTGGTCTGGCTGTTGAACCTTTTTCGTGATTACAAACAGTGTGTGCCTGTACCG
GACATCGCAGCAAAAGTGTCGGTAGCGTCAGCTGAATCATCGGAAGGCCCATTTTATTTTCACAGGCTGC
AAGATCATGTCCGTCATCGTTATGGTCGCTTTTGGCGCCGTAAAGTACGGATATTGATGGTGATGGGGCA
ACGGGAACAAGTGGAAGCGATTGCGCCGGGGCTGACGAAGCAACACTGGCTGGAAGGCGAGAGTAATCTG
TTGCTGTGGGGCGGCAGCTTGCAGGTGGCTCCCGATGTGGCGCAGTTAAAGGCATTACGTAAACTGCGTC
GTCGCTGCCCGTTGGATGGCGTGGTGTGGGTGATGACCGAAGAGCAACTGAGCCAGCGGGCCGAGATAGA
TACCGCATTACGGATGCTGGAGAAACAGGGTCAGCAGCTTGGCTGGCAGGCGCCGGTGTATGTGTGGCAT
GTGCAATGCAGCCTCTGGGACCAGCGTGACCGCCCGACTCAGACGGTTGGCTGTTTCCTGCCATCGGAGA
GCCCGCCGCCGTTGCTGACGGAAAGCCTGAACACCCTGCCGTCGCAACTGGCGGCCAGAGGGATGGCGCA
GGCGTTAGCGAACATCCGCCACGATTTTTTGTTACGGCTGGCGCAGTCTCTGCGGGAGGGGGGAGTCACG
CGTCTGGTTCGTCAGCTGACGCCGCTGTTAAACCGGCCATCGGTATGGATGGCGGGGGTGATGTTCAGTT
TACCGCTGGCCGCTCAGCCGGGGATGACAGAACATGGCTGGCTAGTGGACGCAAGCTGGAACGGGGTACT
GGAGGATGTGCGCCATGTCCGGGGTAACGCGGTGGGTTTCCCGTGGGAGAAAAGTGCCCAGTGGGGATTA
ATTGTGCTGGCGGCGCTGTGGGGGATGGGCAGCGTGACGTCATTTTTTGCGAACCGTCACCAGATAACCT
TGAGCCGTGAGCGGGTCAGTCAGGTCAGTCACCGGCAGCATTCATTATCAGACCGTCTGCTCAGCCAGCA
TGCACTGCAACTAGAGCTTGACCGGTTGCAGCACCGGGCGGAAGCCGGGGCACCGTGGTACAGCCGGTTT
GGGCTGAATCAGAATGGGGTTCTGCTCCGGACACTGTGGCCGGTTTACCAGCGCAACAATGCGCCGCTGA
TACGTGATGCGGCGGCGCGGGTGTTGCATCAGCGGCTGGCCGACTGGGTCAATCTGCCCCCCGGGAGTCC
ACAGCGATGTCAGCAGATGAAAGCGGCTTATGCGCAGCTGAAAGCCTATCTGATGATGGCCCGCCCGGAG
AAAGCGGATGCGGCTTTTATGAGCCGGGTACTGATGGAGAGCTGGCCGCATCGGGCCGGGGTCAGAGATG
GGCTGTGGCAGAACACCGGGGCGTCCCTGCTGCGGTTTTATGCGCAGCATCTGCCGCAGCATCCGGTCTG
GAAAATCATCGCCGATGCCGGGCTGGTCAGTGAAGTGCGCCAGATATTGCTAAATCAGCAGGGTCAGCGC
AATGCGGAAGCGACGCTGTATCAGCACCTGTTGCAACAGGTGGCGCACAGCTACGGGGATTTAAGTCTGG
CACAGATGACCGGGGCCACGGATGCCAGCCGGCTGTTTAGCACGAATAAAGTGGTGCCGGGCATGTTTAC
CCGTCAGGCGTGGGAAGGTCAGGTACAGCAGGCGATAGCGGCGGTGGTGGCTTCCCGGCGTGAAGCGATG
GACTGGGTGTTGAGCGATGGCGGTCAGCCGATGGCGGAAGCGGTTTCGCCGGGGGTGTTACAAGCCCGGC
TGAGGGCACGTTACTTTAGGGATTTCGCGGGGGCCTGGCTGAATTTTCTTAACAGTCTGCGCTGGAATAG
GGTACATAACCTGTCCGATACCCTGGACCAGTTAACTTTGATGGCGGATGTGCGTCAGTCGCCGTTGATA
GCGCTGATGAACACGCTGGCGTATCAGGGAGAAACCGGCCAGCCGGACGAGGGATTATCGGATTCGCTGG
TGAACACGGCCCGGACGCTGTTCCAGAAAACGCCGCCGTTGGTGATTGACCAGAACCGCGGTCCGCAAAG
TCCGATGGAGAACACGTTTGGTCCGTTACTGAGCCTGATGGGAAAAACGCCCGGCCAAGCGCTGATGACG
GCAGACAGTACCCTGAGTCTGCAAACCTTCCTGACGCGGGTGACGCGGGTGCGGCTGACCCTGCAACAAA
TCGCCAATACGGATGACCCGCAGGAGAGGATGCAGGCGCTGGCGCAGACGGTGTTTCAGGGAAAGCGAGT
GGACCTGACGGACACGCAGTCATATGGCAGCCTGATAGCGGCGAGTCTGGGGTCGGACTGGAGCGGATTT
GGTCAGACGGTGTTTGTGCAGCCATTAACACAGGCGTGGCAGACGGTGCTGCAACCGTCAGCGGCGAGTA
TCAATGCGCAGTGGCAGGCGTCGGTGGTGTCAGACTGGCAGGCGGCATTTAACGGGCGTTATCCGTTTGT
CGATGAGCAAAATGAGGCGTCGCTGCCGGTGCTGGGGCAGTTTATTGCGGCGGATACGGGTCGGATTGAG
CAGTTTCTGCAGCGGGAGTTAGGGGGCGTGCTGCATAAAGAGGGCCACTATTGGGTGGCGGATAAAGTGG
GGAGTCAGGGGCTGCTGATTAACCCGGCGTTCCTGACGGCGATAAACCAGCTGAGTGCCATAGCGGATGT
GCTGTTTATGAACGGGCGTCAGGGGCTGCGGTTTGAACTGCGGGCCAAGCCGGTACGGGATGTGGCGGAA
ACGGACCTGACGATAGACGGGCAAAGGCTGCGTTACTTTAACCAGATGGAGAGCTGGCAGCGTCTGCGCT
GGCCGGGGGAGAGCGATAATCCGGGCGTGGTGCTGACGTGGACGAGTGTGGACACCGGGGCGAGGGTGTT
TGGCGATTACCCGGGGGAGTGGGGGCTGCTGCGCTGGCTGGAGCAGGCGAAGGTGAAGGCGTTAGATGGT
GGCCGTTACCGGCTGACGTTTAATGCGCCGGACGGATTACCGCTGAGCTGGGATTTACGCACGGAGCAGG
GGAAAGGGCCGCTGGTCTTGCTGGGGCTGAAAGGGTTCCGGTTGCCGGCCCAGATATTCAGCGAGAAAGA
GGAATAA
 Primer design