SecReT6
Protein ID: 253991262
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03789
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4397816..4398823 [+]
Producthypothetical protein
NoteTssA
UniProt IDB6VLA3
KEGG IDpay:PAU_03789
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 5.10E-21, Aligned region: 52..111
ImpA-rel_N [PF06812], Evalue: 5.10E-21, Aligned region: 121..137
Protein Sequence: 335 a.a.     [Download]
>gi|253991262|ref|YP_003042618.1| hypothetical protein PAU_03789 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MNIASLLNPISQEHPCGEDLEYSAEFMQLIQLAAGKAEQQFGDFIMPAQEPDWRQIEKSALVLLARSKDL
RIIILLMQAWCSQYGLTGYEQGLLLLEQTISRYWETLWPAAELDGEPDLLMRINALQGLSDGFALAKQVR
LCEFAQLNGLILTVADVMKCLDGSSAEDHPFPGGIDLLIAELRKSAAPVIKQIPQIAATLQCLFSTLRHH
LGDSGLPDMRRQMATLNHLTQLLVPETSAVKTVENTAYPPPENTPPQQKISHGWQTSDIQNREQAQQALE
AVRQYFLLHESSHPAPLMIERIQRLMSQDFMSIMRNLAPEAVDQLEHFFGREKHT
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|253987483|ref|NC_012962.1|:4397816-4398823 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGAATATTGCATCTTTGCTTAACCCGATCAGCCAGGAACATCCCTGTGGAGAAGACCTGGAATACAGCG
CCGAATTCATGCAACTGATTCAATTGGCAGCAGGAAAAGCTGAACAGCAATTCGGTGATTTTATCATGCC
AGCTCAGGAACCCGATTGGCGTCAGATAGAGAAAAGTGCCTTGGTTCTGCTGGCTCGTAGTAAGGATCTG
CGCATTATCATCTTGCTAATGCAAGCCTGGTGCAGTCAATACGGTTTGACTGGATATGAACAGGGGCTGC
TGTTATTGGAACAGACGATCAGTCGTTATTGGGAAACATTGTGGCCTGCCGCAGAGCTCGATGGGGAGCC
AGACTTGCTGATGCGTATTAACGCATTACAAGGACTGAGTGATGGTTTCGCGCTGGCTAAACAAGTACGC
CTTTGCGAATTTGCCCAGCTGAACGGACTCATCCTTACAGTAGCGGATGTAATGAAATGTCTAGATGGCA
GTAGTGCGGAAGATCACCCATTTCCTGGTGGGATCGATCTTCTGATCGCCGAATTACGAAAAAGTGCAGC
ACCGGTCATCAAACAGATCCCACAAATAGCGGCCACTCTTCAATGCTTATTTAGCACATTGCGCCATCAT
CTTGGCGACAGCGGGCTACCCGATATGCGCCGTCAGATGGCAACACTTAATCATCTGACACAACTTCTCG
TCCCTGAAACCAGCGCGGTTAAGACGGTGGAAAATACAGCATATCCCCCGCCAGAGAATACACCTCCACA
ACAAAAAATATCCCATGGTTGGCAGACATCTGACATTCAAAACCGCGAACAGGCCCAACAGGCACTAGAA
GCGGTACGACAGTACTTTCTGCTACATGAATCCAGCCATCCGGCACCACTGATGATTGAACGGATACAAC
GCCTAATGAGTCAGGATTTTATGAGCATTATGCGCAACCTTGCGCCGGAAGCTGTCGATCAACTTGAGCA
CTTTTTTGGCCGTGAAAAGCACACATAA
 Primer design

Protein ID: 253991287
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03814
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4429950..4431320 [-]
Producthypothetical protein
NoteTssA
UniProt IDB6VLC8
KEGG IDpay:PAU_03814
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 3.70E-51, Aligned region: 154..185
DUF3702 [PF12486], Evalue: 3.70E-51, Aligned region: 310..455
ImpA-rel_N [PF06812], Evalue: 7.80E-19, Aligned region: 41..101
ImpA-rel_N [PF06812], Evalue: 7.80E-19, Aligned region: 237..252
ImpA-rel_N [PF06812], Evalue: 7.80E-19, Aligned region: 325..335
Protein Sequence: 456 a.a.     [Download]
>gi|253991287|ref|YP_003042643.1| hypothetical protein PAU_03814 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MAAISSGHTVHTGDDPRALPEFRALKEEISKLSHPARPDVDWAKVEQLCLTLFRLNGVELQSAAWYTLAR
AQRAGLAGIDEGLALIDGLVSYQWPQFWPQPVHVRVEIFAWLVVRLQQVLRTCVFAYIDLPLIYRTEKVL
EHLCEVLQRLELKHVSKLDSLRVQLHNSARRLESLEQEKGAVSVSCSSAHVLENNARLMPEKHAQPQLMY
VVHETISSEQPQVKVIRGGPAPRWKAWHGFVAGVALCTLIVTGGWLVDRMQQSPLLAQALLETVHPLPQV
LLPTQLAELHHPDNAVLMSRLQDKIMDVSRKQLTNLDALPPLWRLSHGSQLLQQLRTLWPASQTVQDMEK
QWLQQREATALPMSELENYHLAQSRLQQLTARLDALDEKRGRYLTGSELKSMVFGIRQPLSSTPPLEELL
RQLAEQQKNGAVSPALRQQINTRFSQLLNRYYLLQR
 
Nucleotide Sequence: 1371 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c4431320-4429950 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGGCCGCAATATCATCCGGTCACACCGTACATACTGGGGATGACCCGCGTGCACTGCCTGAATTTAGGG
CACTGAAAGAAGAAATAAGCAAACTGAGTCATCCAGCCCGGCCAGATGTTGACTGGGCCAAAGTTGAACA
GCTTTGTTTAACGTTATTTCGCTTAAATGGCGTAGAACTGCAAAGTGCTGCCTGGTACACACTGGCCCGT
GCCCAGCGCGCTGGATTAGCGGGCATTGATGAAGGGCTGGCACTGATTGATGGGTTAGTGAGCTATCAAT
GGCCGCAATTCTGGCCTCAACCCGTTCATGTGCGGGTTGAAATTTTTGCCTGGCTGGTTGTACGTCTACA
GCAAGTGTTACGGACCTGCGTTTTCGCTTATATTGATCTGCCGCTGATTTATCGCACAGAGAAGGTACTT
GAACATCTGTGTGAAGTGCTTCAACGTTTAGAACTGAAACATGTAAGCAAACTCGACAGCCTCCGTGTAC
AGCTTCACAACAGCGCCCGGCGACTGGAGAGTTTGGAGCAGGAAAAGGGTGCGGTATCCGTCTCTTGCTC
TTCAGCTCATGTTCTGGAGAACAACGCTAGGTTGATGCCGGAGAAACATGCTCAGCCACAACTGATGTAT
GTGGTACACGAAACTATCTCCTCTGAACAACCTCAGGTTAAAGTGATTCGTGGGGGACCTGCACCTCGTT
GGAAAGCCTGGCACGGCTTTGTGGCGGGTGTCGCATTATGTACGCTGATTGTCACGGGGGGCTGGCTGGT
GGACAGGATGCAGCAGTCACCTCTGCTGGCACAGGCTTTGTTAGAAACGGTGCATCCGTTACCGCAAGTA
TTGCTCCCAACACAACTGGCTGAGTTACATCACCCTGATAATGCGGTGCTAATGAGCCGGTTGCAGGATA
AAATCATGGATGTCAGTCGTAAGCAACTGACAAACTTAGACGCATTGCCGCCATTGTGGCGATTGAGCCA
TGGTTCGCAGTTATTACAGCAGCTACGTACATTGTGGCCGGCCAGCCAAACGGTGCAGGATATGGAGAAA
CAGTGGTTACAACAGCGTGAAGCCACTGCCCTGCCGATGTCGGAACTGGAAAATTACCATCTGGCTCAAT
CACGGCTGCAACAACTGACTGCGCGGCTTGACGCATTGGATGAAAAACGCGGGCGATATCTCACCGGCTC
TGAACTGAAATCGATGGTATTTGGCATCAGGCAACCGCTGTCCAGCACACCGCCATTGGAAGAATTATTG
CGCCAACTGGCGGAGCAGCAAAAAAATGGTGCCGTTTCTCCAGCATTACGCCAACAAATTAATACCCGTT
TTAGTCAGTTACTTAATCGCTATTATTTATTGCAGAGGTAG
 Primer design

Protein ID: 253991292
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03819
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4435406..4437007 [-]
Producthypothetical protein
NoteTssA
UniProt IDB6VLD3
KEGG IDpay:PAU_03819
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 8.20E-21, Aligned region: 63..121
ImpA-rel_N [PF06812], Evalue: 8.20E-21, Aligned region: 151..178
ImpA-rel_N [PF06812], Evalue: 8.20E-21, Aligned region: 302..317
Protein Sequence: 533 a.a.     [Download]
>gi|253991292|ref|YP_003042648.1| hypothetical protein PAU_03819 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MLQQLITNCFAERDALAEARERAVRWENWLLPISADAPTGDDPVYNDDFQRMREELNKLSGIDTTLICQL
AEKLLTTECKDVRVATYYVWARLHQEGESGLADGLGLLAALVDRFGETLLPCRASSRKAALEWLVGTKIQ
DSLSLYPEVNRTDFEHIVSALALLEQTFATWDENARPSLVGLAGTLENRLAQSGGVDAVVPQTAAPMPLS
GGQVNSSAQGESSVLWGQVQSGRDLLERARELARYLREQPQGWLSSARLMRSVRWDTVHQLPPLDADGRT
RLVPPRTEYRALLKRLYRQQNWHDLLEQADRMFSESVNHFWLDLQWYLCQALNRLGSSYESWIEMVKHDL
RMLLERLPGLENLAYNDGTPFADEVTAGWIAQQVHDSQADWSFVHSPMQPQHDDDVLALEPEAQQLADSE
GIDAALRWLGQLPSINGARQRWLQRLLMARMAEQYGKNEMALHLLTELNTDGQFNLGEWEPALMFEVKAC
LLKLLRMKAQRSEQDKARMAQRMETLLAGLVAIDPVRAAVLCG
 
Nucleotide Sequence: 1602 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c4437007-4435406 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGTTGCAACAATTGATCACAAACTGCTTTGCCGAGCGTGATGCGCTGGCAGAAGCACGGGAAAGGGCGG
TTCGGTGGGAAAACTGGCTGTTACCCATTAGTGCTGATGCTCCCACAGGCGATGATCCGGTCTATAACGA
CGATTTTCAGCGTATGCGGGAGGAGCTGAACAAGCTCAGTGGCATTGATACCACACTTATCTGTCAATTG
GCGGAGAAACTGTTAACTACCGAATGTAAAGATGTTCGCGTGGCGACCTATTATGTGTGGGCGCGTTTAC
ATCAAGAGGGTGAAAGCGGCTTGGCCGATGGGCTGGGGTTACTGGCTGCACTAGTAGATCGTTTTGGTGA
AACCTTGTTACCTTGCCGGGCGAGCAGTCGAAAAGCTGCGCTGGAGTGGTTGGTAGGCACCAAGATTCAG
GACAGTTTGTCACTCTATCCAGAGGTAAATCGTACCGACTTTGAACATATCGTATCGGCTCTGGCGTTAC
TGGAACAGACGTTTGCTACTTGGGACGAAAATGCCCGGCCCTCCCTTGTTGGGCTGGCAGGCACTCTGGA
AAACCGATTAGCTCAGTCCGGTGGAGTGGATGCGGTGGTTCCCCAAACGGCTGCTCCGATGCCTTTATCT
GGGGGGCAGGTCAATTCATCAGCTCAGGGTGAGTCATCGGTATTATGGGGGCAGGTGCAATCCGGGCGTG
ATCTGTTGGAACGAGCACGTGAATTAGCGCGCTATCTGCGTGAACAGCCTCAAGGCTGGCTCTCTTCTGC
ACGGCTGATGCGGAGTGTCCGCTGGGATACTGTGCATCAATTACCACCACTGGATGCTGACGGGCGTACC
CGTTTGGTACCGCCACGTACAGAATATCGGGCCTTGTTAAAACGGCTCTATCGGCAACAAAACTGGCATG
ATTTATTGGAGCAAGCCGACCGAATGTTCTCGGAAAGTGTTAACCACTTTTGGCTGGATTTGCAGTGGTA
TCTCTGTCAGGCATTAAACCGATTGGGTAGCTCCTATGAAAGTTGGATAGAGATGGTGAAACATGATCTG
AGGATGCTGCTTGAACGGCTGCCGGGGCTGGAAAATCTGGCATATAACGACGGAACGCCTTTTGCCGATG
AAGTCACTGCCGGTTGGATCGCCCAACAGGTTCATGACTCTCAGGCAGACTGGTCATTTGTACATTCACC
GATGCAGCCCCAGCATGATGATGATGTTTTAGCTCTGGAACCAGAGGCGCAACAACTGGCGGACAGCGAA
GGCATAGATGCTGCATTACGCTGGCTGGGGCAGCTGCCGAGTATCAACGGAGCGCGACAGCGCTGGTTAC
AGCGCTTGCTGATGGCTCGGATGGCGGAGCAATACGGCAAAAATGAAATGGCCTTGCATTTGCTGACCGA
GCTAAACACCGATGGACAATTTAATCTTGGTGAATGGGAGCCGGCACTGATGTTTGAGGTGAAAGCATGT
CTGTTGAAGTTGCTGCGGATGAAAGCACAGCGCAGTGAACAGGATAAAGCGCGGATGGCGCAGCGCATGG
AGACTTTGTTAGCTGGACTAGTGGCGATTGATCCGGTCAGAGCTGCTGTGCTATGTGGCTGA
 Primer design