SecReT6
Protein ID: 253991263
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03790
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4398923..4399480 [+]
Producthypothetical protein
NoteTssB
UniProt IDB6VLA4
KEGG IDpay:PAU_03790
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.20E-57, Aligned region: 11..162
Protein Sequence: 185 a.a.     [Download]
>gi|253991263|ref|YP_003042619.1| hypothetical protein PAU_03790 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MSGSNSGQKFIARNRAPRVQIEYDVELYGSERKVQLPFVMGVMSDLAGKSADQLPPLGQRKFLDIDVDNF
DDRMKSLCPSVAFPVDNTLSGEGKIQVALTFNTMDDFLPDSIARQVEPLNQLLEARTQLANLLSYMDGKS
GAEELIASILQNPELLKSLSTAPLNNTESTDSVAKQDQGGTHEPV
 
Nucleotide Sequence: 558 bp     [Download]
>gi|253987483|ref|NC_012962.1|:4398923-4399480 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGTCAGGATCAAATAGCGGGCAAAAATTCATCGCTCGTAACCGTGCTCCACGAGTACAAATTGAATATG
ACGTCGAACTATACGGTAGTGAACGTAAAGTTCAGCTGCCTTTTGTCATGGGCGTCATGTCGGATTTAGC
CGGAAAATCTGCTGATCAACTTCCTCCGCTAGGTCAGCGCAAGTTTCTCGATATTGATGTTGATAACTTC
GATGACCGTATGAAATCACTATGCCCAAGCGTGGCTTTTCCGGTGGACAACACCCTGAGCGGTGAAGGCA
AAATTCAGGTCGCACTCACTTTCAACACCATGGATGACTTTCTACCTGATTCGATAGCACGTCAGGTAGA
ACCGCTTAATCAACTCCTGGAAGCCCGTACTCAGTTAGCTAATCTGCTGTCCTATATGGACGGCAAAAGT
GGTGCCGAAGAGTTGATCGCGTCCATCCTGCAAAATCCTGAATTACTGAAATCATTAAGTACTGCACCGT
TGAATAATACCGAGTCCACCGACTCGGTAGCAAAACAAGATCAAGGAGGCACTCATGAGCCAGTCTGA
 Primer design