SecReT6
Protein ID: 253991264
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03791
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4399467..4400975 [+]
Producthypothetical protein
NoteTssC
UniProt IDB6VLA5
KEGG IDpay:PAU_03791
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.70E-193, Aligned region: 69..495
Protein Sequence: 502 a.a.     [Download]
>gi|253991264|ref|YP_003042620.1| hypothetical protein PAU_03791 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MSQSEIHAASENQTQTDSYSQGELSALLKKEFRPKTDQARLAVENAVKTLAHQALENSLTLSSDTFSTIQ
ALIAAIDNKLSQQINEILHHPDFQALEGAWRGLLYLVNNTETSEMLKIRVMSVEKKELGRTLKRYKGTAW
DQSPVFKRIYEEEYGQFGGEPLGCLVGDYYFDHNPQDVELLGEMARIAAAAHCPFISSASPGVMQMETWQ
ELANPRDLSKIFLNTEYASWRSLRESEDARYIGLVMPRFLARLPYGISTNPVEGFDFEEKTAGATHSNYV
WSNAAYAMAVNINRSFKEYGWCASIRGVESGGAVDKLICHTFPTDDGGLDIKCPTEIAISDRREAELAKN
GFIPLVYRKNSDFAAFIGAQSLQKPAEYMDADATANANLAARLPYLFACCRFAHYLKCIVRDKVGSFQNR
NDIERWLNKWILNYVDGDPANSSQQTKARKPLAAAEVQVSEQEDNPGYYQAKFFLRPHYQLEGLTVSLRL
VSKLPSLKQSGG
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|253987483|ref|NC_012962.1|:4399467-4400975 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGAGCCAGTCTGAAATCCATGCTGCCAGTGAAAACCAAACTCAGACCGACAGTTACAGCCAGGGAGAGC
TCAGTGCACTACTCAAAAAAGAGTTTCGCCCGAAAACAGATCAAGCACGCCTTGCGGTGGAAAATGCGGT
TAAAACTCTGGCACATCAGGCTCTGGAAAATAGCCTGACATTATCGAGCGACACTTTCAGCACCATTCAA
GCGCTGATTGCCGCTATTGACAACAAACTCTCTCAACAGATCAACGAAATTCTCCATCATCCTGATTTTC
AGGCTCTGGAGGGGGCATGGCGTGGGCTGCTCTATCTGGTGAACAACACAGAAACCAGCGAAATGCTAAA
AATACGTGTTATGAGCGTCGAGAAGAAAGAGTTAGGACGCACACTGAAACGCTATAAAGGAACAGCCTGG
GATCAAAGTCCTGTTTTCAAACGGATTTATGAAGAAGAATACGGCCAATTTGGCGGAGAACCTCTTGGTT
GTCTGGTCGGTGATTACTATTTCGACCACAATCCGCAGGACGTTGAGTTGCTGGGAGAAATGGCCCGTAT
CGCTGCCGCTGCCCATTGTCCTTTTATCAGCAGCGCTTCGCCCGGAGTGATGCAAATGGAAACCTGGCAA
GAGCTAGCAAACCCGCGCGATCTAAGCAAGATCTTTCTCAACACCGAATACGCATCTTGGCGTAGTTTGC
GTGAATCAGAAGATGCCCGTTATATCGGCTTAGTCATGCCACGTTTTCTGGCTCGTTTACCTTACGGAAT
CAGTACCAATCCAGTTGAAGGATTCGATTTCGAAGAAAAAACCGCTGGGGCCACTCATAGTAACTACGTA
TGGAGCAACGCAGCCTATGCCATGGCGGTCAATATCAATCGCTCATTTAAAGAATATGGCTGGTGTGCAT
CCATCCGAGGCGTCGAGTCAGGCGGAGCGGTAGATAAACTGATATGTCACACTTTCCCGACAGATGATGG
CGGTTTAGATATCAAATGCCCGACCGAAATCGCAATCAGTGATCGCCGCGAGGCCGAGTTAGCCAAAAAC
GGTTTTATCCCGTTGGTTTATCGTAAAAACTCTGATTTTGCCGCGTTTATCGGCGCTCAATCACTGCAAA
AACCGGCGGAATATATGGATGCGGATGCCACAGCAAACGCTAATCTGGCCGCCCGTTTACCTTATCTATT
TGCCTGCTGCCGCTTCGCGCATTATCTGAAATGCATAGTGCGTGACAAAGTGGGATCGTTTCAAAACCGC
AATGACATTGAACGCTGGTTGAATAAATGGATTCTCAACTATGTTGACGGCGATCCCGCTAACTCCTCAC
AACAGACCAAAGCGCGTAAACCGCTGGCAGCGGCGGAAGTACAAGTTAGCGAACAGGAAGATAACCCCGG
CTACTATCAAGCCAAATTCTTCCTGCGTCCCCATTATCAACTGGAGGGATTAACTGTTTCCCTACGGTTG
GTATCAAAACTGCCTTCTCTAAAACAGAGTGGCGGTTAA
 Primer design