SecReT6
Protein ID: 253991265
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03792
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4401008..4401529 [+]
Producthypothetical protein
NoteTssD
UniProt IDB6VLA6
KEGG IDpay:PAU_03792
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.70E-26, Aligned region: 6..111
DUF796 [PF05638], Evalue: 1.70E-26, Aligned region: 154..166
Protein Sequence: 173 a.a.     [Download]
>gi|253991265|ref|YP_003042621.1| hypothetical protein PAU_03792 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MNNSIYLDIKDVSGECKDSNHPNGIDVHTFKWELSQPVETGSGGGGGSGRAKIHSLVVYARMDKAMPTLM
QKLALGTHLPEVKLTMRKAGSEQQEFTTITLESALLDSIELVDFNRDIPHLTEGSTDIKPGTIGVKYSFS
PNKAKVIYKEQDNEGKSGAEVEFKWNTQTNRPE
 
Nucleotide Sequence: 522 bp     [Download]
>gi|253987483|ref|NC_012962.1|:4401008-4401529 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGAACAACAGTATCTATCTGGATATCAAAGATGTCTCCGGTGAATGTAAAGACAGCAATCATCCCAATG
GTATTGATGTCCATACCTTTAAATGGGAGCTGTCACAACCAGTAGAAACCGGTAGCGGTGGCGGTGGCGG
AAGTGGGCGCGCCAAAATTCACTCTCTGGTGGTCTACGCCCGTATGGATAAGGCAATGCCAACGTTAATG
CAGAAATTAGCGCTAGGAACTCATCTTCCTGAAGTGAAGTTAACCATGCGCAAGGCTGGAAGTGAGCAAC
AAGAGTTCACCACTATTACACTTGAAAGTGCGTTACTTGACAGCATTGAGCTGGTTGATTTTAACCGTGA
CATTCCGCATCTGACAGAAGGTTCAACTGACATTAAGCCCGGTACAATTGGCGTGAAATACAGCTTCTCT
CCGAATAAAGCCAAAGTAATTTATAAGGAACAGGATAACGAAGGAAAAAGCGGTGCTGAAGTGGAATTTA
AATGGAACACACAAACGAACCGCCCTGAATAG
 Primer design

Protein ID: 253991306
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03833
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4456998..4457489 [-]
Producthypothetical protein
NoteTssD
UniProt IDC7BMP2
KEGG IDpay:PAU_03833
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.30E-37, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|253991306|ref|YP_003042662.1| hypothetical protein PAU_03833 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MAIPAYLWLKDDGGADIKGSVDVQNREGSIEIVALEHALHIPTDNNTGKLTGTRVHAPLVFTKEVDASSP
YLYKAVTSGQTLKSAEIKWYKIDDAGQEKEYFNTRLDNVKVVKVAPLMHDIKDPAKEKHNHLEQVEFRYE
KITWTYKDGNIIHSDAWNERNQA
 
Nucleotide Sequence: 492 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c4457489-4456998 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGGCTATCCCCGCTTATTTGTGGCTAAAAGATGACGGCGGTGCGGACATCAAAGGGTCTGTCGATGTAC
AGAACCGTGAAGGCAGCATCGAAATTGTGGCGTTGGAACATGCTTTACATATTCCGACGGACAACAATAC
TGGCAAGCTGACCGGAACCCGCGTGCACGCTCCGCTAGTGTTCACGAAAGAAGTCGATGCTTCAAGTCCT
TATTTGTATAAAGCGGTCACTTCCGGCCAAACCCTGAAATCAGCAGAAATCAAGTGGTACAAAATTGATG
ATGCGGGTCAGGAGAAGGAATATTTCAACACCCGACTGGACAACGTGAAGGTGGTGAAAGTGGCGCCGCT
GATGCATGACATCAAAGATCCTGCCAAAGAGAAACACAATCATCTGGAACAAGTTGAGTTCCGCTACGAA
AAAATCACCTGGACGTACAAAGACGGCAACATCATTCACTCGGATGCGTGGAATGAGCGCAATCAGGCGT
AG
 Primer design