SecReT6
Protein ID: 253991266
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03793
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4401671..4402666 [+]
Producthypothetical protein
NoteFha
UniProt IDB6VLA7
KEGG IDpay:PAU_03793
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 0.00043, Aligned region: 27..94
Protein Sequence: 331 a.a.     [Download]
>gi|253991266|ref|YP_003042622.1| hypothetical protein PAU_03793 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MQITIINTPAGDMTANSSHIFYPPGGTIGTSEDNHFVLPDPSNCISALQASVHISTQGACTITNIGTAFM
MINNIPLARGETTSLQENSKLQIGNYSLTVNKTETTKYRSAEQEIPETDISAALWDELNATLPTEKNPTE
DEQLSLANFMLPKQGTEPVLSLDQLATRPTDPMQLFTAQRHSASGHTLFQQNTRQSVTPLQLWEEQVKQL
DPLCMFKKEPTTATANDMTAPQTYQMSDRHEQAMKEALFYCLNSIMNRFDPSYDENSVPAAHFWHMNGTQ
HRKAKLWDNFTERYQQTTEEIRQQSSTLFNAFFLSIYQQKLNTIFDNNNGE
 
Nucleotide Sequence: 996 bp     [Download]
>gi|253987483|ref|NC_012962.1|:4401671-4402666 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGCAAATAACCATCATCAATACTCCAGCAGGTGACATGACAGCAAATAGCAGTCATATTTTTTATCCTC
CCGGTGGCACTATCGGTACCAGCGAAGATAATCATTTTGTGTTGCCAGATCCGAGTAATTGTATTTCGGC
ATTACAAGCCAGTGTACATATTTCTACCCAAGGTGCCTGCACTATTACTAATATTGGAACTGCTTTCATG
ATGATTAATAATATCCCATTAGCGCGTGGAGAAACCACATCTCTACAAGAAAATAGCAAACTCCAGATTG
GAAATTATTCCCTGACGGTGAATAAAACGGAAACAACAAAATACCGTTCTGCCGAACAGGAAATACCAGA
AACTGATATTTCCGCAGCACTATGGGATGAATTAAATGCAACATTGCCCACAGAAAAAAATCCTACAGAG
GACGAGCAGCTGTCATTAGCAAATTTTATGCTACCGAAACAAGGAACAGAGCCTGTGCTATCCCTTGACC
AACTTGCTACCCGCCCCACTGATCCAATGCAACTCTTTACGGCCCAACGTCACAGTGCTAGCGGTCATAC
TCTGTTTCAACAAAATACCCGCCAATCTGTTACACCATTGCAACTATGGGAAGAGCAGGTAAAACAGCTC
GATCCGCTATGCATGTTCAAAAAAGAACCGACAACCGCCACTGCCAACGACATGACCGCCCCACAAACAT
ATCAAATGTCAGACAGACACGAACAGGCAATGAAAGAAGCACTTTTCTATTGCCTTAACTCCATCATGAA
TCGTTTTGACCCATCCTACGACGAAAACAGTGTCCCCGCAGCGCACTTCTGGCACATGAATGGCACACAG
CACCGTAAGGCAAAATTGTGGGATAATTTCACTGAGCGTTACCAACAAACTACCGAAGAGATACGTCAGC
AATCATCGACATTATTCAATGCCTTTTTCCTCAGTATTTATCAACAAAAATTAAACACGATTTTCGACAA
CAATAATGGCGAATAA
 Primer design