SecReT6
Protein ID: 253991271
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03798
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4406762..4409386 [-]
Producthypothetical protein
NoteTssH
UniProt IDB6VLB2
KEGG IDpay:PAU_03798
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.20E-40, Aligned region: 135..170
AAA_2 [PF07724], Evalue: 3.20E-40, Aligned region: 220..239
AAA_2 [PF07724], Evalue: 3.20E-40, Aligned region: 283..299
AAA_2 [PF07724], Evalue: 3.20E-40, Aligned region: 606..772
AAA [PF00004], Evalue: 4.40E-19, Aligned region: 222..353
AAA [PF00004], Evalue: 4.40E-19, Aligned region: 612..696
ClpB_D2-small [PF10431], Evalue: 3.30E-16, Aligned region: 779..854
AAA_5 [PF07728], Evalue: 2.30E-11, Aligned region: 222..301
AAA_5 [PF07728], Evalue: 2.30E-11, Aligned region: 611..731
AAA_22 [PF13401], Evalue: 2.30E-08, Aligned region: 222..303
AAA_22 [PF13401], Evalue: 2.30E-08, Aligned region: 362..388
AAA_22 [PF13401], Evalue: 2.30E-08, Aligned region: 504..526
AAA_22 [PF13401], Evalue: 2.30E-08, Aligned region: 610..635
AAA_22 [PF13401], Evalue: 2.30E-08, Aligned region: 673..696
AAA_16 [PF13191], Evalue: 8.60E-08, Aligned region: 34..78
AAA_16 [PF13191], Evalue: 8.60E-08, Aligned region: 199..242
AAA_16 [PF13191], Evalue: 8.60E-08, Aligned region: 266..300
AAA_16 [PF13191], Evalue: 8.60E-08, Aligned region: 597..647
AAA_16 [PF13191], Evalue: 8.60E-08, Aligned region: 751..787
AAA_14 [PF13173], Evalue: 7.80E-07, Aligned region: 57..78
AAA_14 [PF13173], Evalue: 7.80E-07, Aligned region: 222..304
AAA_14 [PF13173], Evalue: 7.80E-07, Aligned region: 329..388
AAA_14 [PF13173], Evalue: 7.80E-07, Aligned region: 610..698
Sigma54_activat [PF00158], Evalue: 8.50E-07, Aligned region: 207..236
Sigma54_activat [PF00158], Evalue: 8.50E-07, Aligned region: 293..302
Sigma54_activat [PF00158], Evalue: 8.50E-07, Aligned region: 375..390
Sigma54_activat [PF00158], Evalue: 8.50E-07, Aligned region: 610..735
AAA_25 [PF13481], Evalue: 1.90E-06, Aligned region: 217..259
AAA_25 [PF13481], Evalue: 1.90E-06, Aligned region: 607..637
IstB_IS21 [PF01695], Evalue: 5.00E-06, Aligned region: 204..241
IstB_IS21 [PF01695], Evalue: 5.00E-06, Aligned region: 611..631
Arch_ATPase [PF01637], Evalue: 5.30E-06, Aligned region: 200..236
Arch_ATPase [PF01637], Evalue: 5.30E-06, Aligned region: 275..376
Arch_ATPase [PF01637], Evalue: 5.30E-06, Aligned region: 610..627
AAA_17 [PF13207], Evalue: 7.20E-06, Aligned region: 222..246
AAA_17 [PF13207], Evalue: 7.20E-06, Aligned region: 610..647
AAA_19 [PF13245], Evalue: 8.80E-06, Aligned region: 220..244
AAA_19 [PF13245], Evalue: 8.80E-06, Aligned region: 608..633
NACHT [PF05729], Evalue: 5.40E-05, Aligned region: 222..250
NACHT [PF05729], Evalue: 5.40E-05, Aligned region: 471..520
NACHT [PF05729], Evalue: 5.40E-05, Aligned region: 611..647
NACHT [PF05729], Evalue: 5.40E-05, Aligned region: 822..850
AAA_18 [PF13238], Evalue: 7.30E-05, Aligned region: 222..242
AAA_18 [PF13238], Evalue: 7.30E-05, Aligned region: 612..637
AAA_29 [PF13555], Evalue: 0.00011, Aligned region: 213..238
AAA_29 [PF13555], Evalue: 0.00011, Aligned region: 609..635
Clp_N [PF02861], Evalue: 0.00019, Aligned region: 27..75
Clp_N [PF02861], Evalue: 0.00019, Aligned region: 112..123
TIP49 [PF06068], Evalue: 0.00023, Aligned region: 222..265
TIP49 [PF06068], Evalue: 0.00023, Aligned region: 273..302
TIP49 [PF06068], Evalue: 0.00023, Aligned region: 610..646
Zeta_toxin [PF06414], Evalue: 0.0004, Aligned region: 222..241
Zeta_toxin [PF06414], Evalue: 0.0004, Aligned region: 603..651
RNA_helicase [PF00910], Evalue: 0.0025, Aligned region: 223..243
RNA_helicase [PF00910], Evalue: 0.0025, Aligned region: 612..633
RNA_helicase [PF00910], Evalue: 0.0025, Aligned region: 709..730
T2SE [PF00437], Evalue: 0.0033, Aligned region: 208..239
T2SE [PF00437], Evalue: 0.0033, Aligned region: 601..643
DUF258 [PF03193], Evalue: 0.0042, Aligned region: 217..239
DUF258 [PF03193], Evalue: 0.0042, Aligned region: 593..624
Hpr_kinase_C [PF07475], Evalue: 0.005, Aligned region: 222..234
Hpr_kinase_C [PF07475], Evalue: 0.005, Aligned region: 490..512
Hpr_kinase_C [PF07475], Evalue: 0.005, Aligned region: 609..630
AAA_23 [PF13476], Evalue: 0.005, Aligned region: 222..239
AAA_23 [PF13476], Evalue: 0.005, Aligned region: 461..527
AAA_23 [PF13476], Evalue: 0.005, Aligned region: 609..639
RuvB_N [PF05496], Evalue: 0.009, Aligned region: 220..239
RuvB_N [PF05496], Evalue: 0.009, Aligned region: 277..302
RuvB_N [PF05496], Evalue: 0.009, Aligned region: 579..632
Protein Sequence: 874 a.a.     [Download]
>gi|253991271|ref|YP_003042627.1| hypothetical protein PAU_03798 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MPDINRQSLFNKLNPPLFSALESASAFCKLRGNPYVELAHWLHQLMQQKAGDLQQIMGHFALDEQQVARD
IVQALDMLPRGASAISDLSAHIDEAVERAWVCSSVTFAAGEIRGAHLLLALLTTFNLRQHLLAISAQFAR
INAGSLAQDFTHILSNSTENGPQRTQAENGNNQSTSESALQNYAQDMTALARDGRIDPVVGRDKEIRQLV
DILLRRRQNNPLITGEAGVGKTALVEGLALRIASGDLPPSLCHVQLWSLDIGRLEAGAGMKGEFEARLQA
VINEVQQSPVPIILFIDEIHMLIGAGGAQGVGDAANLLKPALARGQLRTIGATTWAEYKKHIEKDPALTR
RFQVLQVEQPDEALALQMIRSLSGQLEQHHGVLLLDEALEAAVSLSHRYIPARQLPDKAIALLDTTCARV
AVSQHSQPAVLEDYRRQLDALQIEYEIVCREQQLGGDHDARLAQLDEQRGELRAEEELMVQRWQAEIALA
QQIISLRQQLIANDETAVDDAQRLAWQTQLQDCRQQLSLLQGEQPLITVAVDAHSVAAVVADWTGIPLGR
MVKNELNVVQNLEHSLGQRVIGQQYALNIISERVRTARAHLADPSRPVGVFLLCGPSGVGKTETALALAE
SLYGGEQNLITINMSEFQEPHSVSTLKGAPPGYVGYGEGGVLTEAVRRRPYSLVLLDEVEKAHSDVHELF
FQVFDKGWMEDGEGRRIDFRNTLIILTSNVGSQEVINACSRQDGLPNIETLTQQLRQPLLRAFPAALLGR
LTVLPFLSLSDEMLENIVQLQLARVAQRLRENHGIAAQFDHRVTRQIMSCCMEQESGARRIDSIITNTLL
PQISRKLLTATIENQHYSQLQVTWEETAFQCHFC
 
Nucleotide Sequence: 2625 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c4409386-4406762 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGCCAGATATCAATCGCCAGTCACTATTTAATAAACTTAATCCGCCCTTGTTTAGTGCTTTGGAAAGCG
CCAGTGCATTTTGTAAGCTACGGGGCAATCCTTATGTTGAACTGGCGCACTGGTTGCATCAGCTAATGCA
GCAGAAAGCGGGCGATCTACAACAGATCATGGGCCATTTTGCCTTGGATGAGCAGCAGGTGGCACGGGAT
ATTGTGCAAGCGCTGGATATGTTACCGCGTGGAGCGAGCGCGATTTCTGATCTTTCTGCACATATTGACG
AGGCAGTAGAACGGGCTTGGGTGTGTAGTTCTGTGACCTTTGCGGCAGGTGAAATTCGTGGTGCTCACCT
GTTGCTGGCCCTGTTGACGACTTTTAATCTGCGCCAGCATTTGTTAGCTATTTCCGCTCAGTTTGCCCGT
ATTAATGCGGGAAGTTTGGCGCAGGATTTTACTCATATCCTGAGCAACAGTACGGAAAATGGTCCTCAGA
GAACGCAGGCAGAGAATGGGAATAATCAGTCAACATCAGAGAGTGCGTTACAAAATTATGCGCAGGATAT
GACTGCACTCGCGAGGGATGGGCGAATTGATCCTGTTGTTGGTCGGGATAAAGAGATTCGCCAATTGGTT
GATATTCTGCTACGCCGTCGGCAAAACAATCCTTTGATTACTGGTGAGGCTGGCGTGGGTAAAACGGCGC
TGGTGGAAGGATTGGCATTGCGTATTGCATCGGGTGATTTGCCGCCGTCATTGTGTCATGTTCAGCTTTG
GTCATTGGATATTGGCCGTTTGGAAGCGGGCGCTGGCATGAAAGGAGAATTTGAGGCACGTTTGCAAGCG
GTGATTAATGAAGTTCAGCAAAGCCCGGTTCCCATTATTCTGTTTATTGATGAGATACATATGCTAATTG
GTGCGGGCGGTGCGCAAGGAGTTGGTGACGCCGCGAATTTGTTAAAACCGGCTCTGGCGCGTGGACAGTT
GCGGACTATTGGTGCCACCACCTGGGCGGAATACAAAAAGCATATTGAAAAAGATCCGGCGCTGACCCGG
CGTTTCCAGGTATTACAGGTCGAACAGCCAGACGAAGCGCTAGCTTTACAAATGATACGGAGTTTGTCTG
GGCAACTGGAACAGCATCATGGTGTGTTATTACTGGACGAGGCGCTGGAAGCGGCGGTATCGCTCTCTCA
TCGTTATATTCCGGCTCGCCAATTGCCTGATAAAGCCATAGCTTTGCTTGATACCACCTGTGCACGGGTC
GCGGTTAGCCAGCACAGTCAACCGGCGGTATTGGAGGATTATCGCCGTCAGCTTGATGCACTCCAAATTG
AATATGAGATTGTTTGCCGCGAGCAGCAACTGGGGGGGGATCATGATGCACGCTTGGCTCAGCTTGATGA
GCAGCGCGGTGAATTGCGGGCGGAGGAAGAACTGATGGTTCAACGTTGGCAGGCTGAAATAGCACTAGCT
CAGCAGATTATCAGCTTGCGCCAACAACTGATTGCTAATGATGAAACTGCGGTAGATGATGCACAGCGTC
TGGCCTGGCAGACACAGTTACAGGATTGTCGGCAACAATTGAGTTTGTTGCAGGGAGAACAGCCATTAAT
CACGGTGGCGGTGGATGCGCACAGTGTTGCGGCGGTGGTTGCGGATTGGACCGGCATCCCGCTTGGTCGG
ATGGTAAAAAATGAGCTCAATGTTGTTCAGAATCTGGAACACAGCTTAGGGCAACGGGTTATTGGTCAGC
AATACGCGCTAAATATCATCAGTGAGCGGGTGCGGACAGCGCGTGCACATTTGGCTGATCCTAGTAGACC
GGTGGGAGTATTTCTGCTGTGTGGTCCTTCTGGAGTCGGGAAGACCGAAACGGCATTAGCACTTGCTGAG
AGCCTATATGGTGGTGAACAGAATCTGATTACCATCAATATGAGTGAGTTTCAGGAGCCACACAGCGTAT
CAACTCTGAAAGGGGCGCCACCGGGATATGTTGGTTATGGTGAAGGTGGAGTCTTAACAGAAGCGGTTCG
GCGACGCCCATACAGTTTGGTGTTGCTTGATGAGGTGGAAAAAGCCCATTCTGATGTGCATGAACTGTTT
TTTCAGGTATTCGATAAAGGCTGGATGGAAGATGGTGAAGGTCGGCGCATTGATTTCCGTAATACACTGA
TCATATTGACCTCGAATGTGGGTAGTCAGGAAGTTATCAACGCTTGTAGCCGGCAGGATGGTTTGCCGAA
TATAGAAACGTTGACACAGCAGTTACGCCAACCGTTGTTACGGGCTTTTCCTGCCGCACTGCTTGGCCGT
TTGACGGTTCTTCCTTTTTTATCATTGAGTGACGAAATGTTGGAAAATATTGTGCAATTGCAGCTGGCGC
GGGTGGCACAACGTTTGCGGGAAAATCATGGTATTGCAGCGCAGTTTGACCACCGAGTGACGCGACAGAT
TATGTCCTGTTGTATGGAACAGGAATCTGGTGCTCGCAGGATTGATTCGATTATTACGAATACTTTATTA
CCGCAAATTAGTCGTAAGTTGCTGACCGCAACAATAGAGAATCAGCATTATTCACAATTGCAGGTAACTT
GGGAGGAGACGGCGTTTCAGTGTCATTTTTGCTGA
 Primer design