SecReT6
Protein ID: 253991271
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03798
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4406762..4409386 [-]
Producthypothetical protein
NoteTssH
UniProt IDB6VLB2
KEGG IDpay:PAU_03798
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.20E-40, Aligned region: 135..170
AAA_2 [PF07724], Evalue: 3.20E-40, Aligned region: 220..239
AAA_2 [PF07724], Evalue: 3.20E-40, Aligned region: 283..299
AAA_2 [PF07724], Evalue: 3.20E-40, Aligned region: 606..772
AAA [PF00004], Evalue: 4.40E-19, Aligned region: 222..353
AAA [PF00004], Evalue: 4.40E-19, Aligned region: 612..696
ClpB_D2-small [PF10431], Evalue: 3.30E-16, Aligned region: 779..854
AAA_5 [PF07728], Evalue: 2.30E-11, Aligned region: 222..301
AAA_5 [PF07728], Evalue: 2.30E-11, Aligned region: 611..731
AAA_22 [PF13401], Evalue: 2.30E-08, Aligned region: 222..303
AAA_22 [PF13401], Evalue: 2.30E-08, Aligned region: 362..388
AAA_22 [PF13401], Evalue: 2.30E-08, Aligned region: 504..526
AAA_22 [PF13401], Evalue: 2.30E-08, Aligned region: 610..635
AAA_22 [PF13401], Evalue: 2.30E-08, Aligned region: 673..696
AAA_16 [PF13191], Evalue: 8.60E-08, Aligned region: 34..78
AAA_16 [PF13191], Evalue: 8.60E-08, Aligned region: 199..242
AAA_16 [PF13191], Evalue: 8.60E-08, Aligned region: 266..300
AAA_16 [PF13191], Evalue: 8.60E-08, Aligned region: 597..647
AAA_16 [PF13191], Evalue: 8.60E-08, Aligned region: 751..787
AAA_14 [PF13173], Evalue: 7.80E-07, Aligned region: 57..78
AAA_14 [PF13173], Evalue: 7.80E-07, Aligned region: 222..304
AAA_14 [PF13173], Evalue: 7.80E-07, Aligned region: 329..388
AAA_14 [PF13173], Evalue: 7.80E-07, Aligned region: 610..698
Sigma54_activat [PF00158], Evalue: 8.50E-07, Aligned region: 207..236
Sigma54_activat [PF00158], Evalue: 8.50E-07, Aligned region: 293..302
Sigma54_activat [PF00158], Evalue: 8.50E-07, Aligned region: 375..390
Sigma54_activat [PF00158], Evalue: 8.50E-07, Aligned region: 610..735
AAA_25 [PF13481], Evalue: 1.90E-06, Aligned region: 217..259
AAA_25 [PF13481], Evalue: 1.90E-06, Aligned region: 607..637
IstB_IS21 [PF01695], Evalue: 5.00E-06, Aligned region: 204..241
IstB_IS21 [PF01695], Evalue: 5.00E-06, Aligned region: 611..631
Arch_ATPase [PF01637], Evalue: 5.30E-06, Aligned region: 200..236
Arch_ATPase [PF01637], Evalue: 5.30E-06, Aligned region: 275..376
Arch_ATPase [PF01637], Evalue: 5.30E-06, Aligned region: 610..627
AAA_17 [PF13207], Evalue: 7.20E-06, Aligned region: 222..246
AAA_17 [PF13207], Evalue: 7.20E-06, Aligned region: 610..647
AAA_19 [PF13245], Evalue: 8.80E-06, Aligned region: 220..244
AAA_19 [PF13245], Evalue: 8.80E-06, Aligned region: 608..633
NACHT [PF05729], Evalue: 5.40E-05, Aligned region: 222..250
NACHT [PF05729], Evalue: 5.40E-05, Aligned region: 471..520
NACHT [PF05729], Evalue: 5.40E-05, Aligned region: 611..647
NACHT [PF05729], Evalue: 5.40E-05, Aligned region: 822..850
AAA_18 [PF13238], Evalue: 7.30E-05, Aligned region: 222..242
AAA_18 [PF13238], Evalue: 7.30E-05, Aligned region: 612..637
AAA_29 [PF13555], Evalue: 0.00011, Aligned region: 213..238
AAA_29 [PF13555], Evalue: 0.00011, Aligned region: 609..635
Clp_N [PF02861], Evalue: 0.00019, Aligned region: 27..75
Clp_N [PF02861], Evalue: 0.00019, Aligned region: 112..123
TIP49 [PF06068], Evalue: 0.00023, Aligned region: 222..265
TIP49 [PF06068], Evalue: 0.00023, Aligned region: 273..302
TIP49 [PF06068], Evalue: 0.00023, Aligned region: 610..646
Zeta_toxin [PF06414], Evalue: 0.0004, Aligned region: 222..241
Zeta_toxin [PF06414], Evalue: 0.0004, Aligned region: 603..651
RNA_helicase [PF00910], Evalue: 0.0025, Aligned region: 223..243
RNA_helicase [PF00910], Evalue: 0.0025, Aligned region: 612..633
RNA_helicase [PF00910], Evalue: 0.0025, Aligned region: 709..730
T2SE [PF00437], Evalue: 0.0033, Aligned region: 208..239
T2SE [PF00437], Evalue: 0.0033, Aligned region: 601..643
DUF258 [PF03193], Evalue: 0.0042, Aligned region: 217..239
DUF258 [PF03193], Evalue: 0.0042, Aligned region: 593..624
Hpr_kinase_C [PF07475], Evalue: 0.005, Aligned region: 222..234
Hpr_kinase_C [PF07475], Evalue: 0.005, Aligned region: 490..512
Hpr_kinase_C [PF07475], Evalue: 0.005, Aligned region: 609..630
AAA_23 [PF13476], Evalue: 0.005, Aligned region: 222..239
AAA_23 [PF13476], Evalue: 0.005, Aligned region: 461..527
AAA_23 [PF13476], Evalue: 0.005, Aligned region: 609..639
RuvB_N [PF05496], Evalue: 0.009, Aligned region: 220..239
RuvB_N [PF05496], Evalue: 0.009, Aligned region: 277..302
RuvB_N [PF05496], Evalue: 0.009, Aligned region: 579..632
Protein Sequence: 874 a.a.     [Download]
>gi|253991271|ref|YP_003042627.1| hypothetical protein PAU_03798 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MPDINRQSLFNKLNPPLFSALESASAFCKLRGNPYVELAHWLHQLMQQKAGDLQQIMGHFALDEQQVARD
IVQALDMLPRGASAISDLSAHIDEAVERAWVCSSVTFAAGEIRGAHLLLALLTTFNLRQHLLAISAQFAR
INAGSLAQDFTHILSNSTENGPQRTQAENGNNQSTSESALQNYAQDMTALARDGRIDPVVGRDKEIRQLV
DILLRRRQNNPLITGEAGVGKTALVEGLALRIASGDLPPSLCHVQLWSLDIGRLEAGAGMKGEFEARLQA
VINEVQQSPVPIILFIDEIHMLIGAGGAQGVGDAANLLKPALARGQLRTIGATTWAEYKKHIEKDPALTR
RFQVLQVEQPDEALALQMIRSLSGQLEQHHGVLLLDEALEAAVSLSHRYIPARQLPDKAIALLDTTCARV
AVSQHSQPAVLEDYRRQLDALQIEYEIVCREQQLGGDHDARLAQLDEQRGELRAEEELMVQRWQAEIALA
QQIISLRQQLIANDETAVDDAQRLAWQTQLQDCRQQLSLLQGEQPLITVAVDAHSVAAVVADWTGIPLGR
MVKNELNVVQNLEHSLGQRVIGQQYALNIISERVRTARAHLADPSRPVGVFLLCGPSGVGKTETALALAE
SLYGGEQNLITINMSEFQEPHSVSTLKGAPPGYVGYGEGGVLTEAVRRRPYSLVLLDEVEKAHSDVHELF
FQVFDKGWMEDGEGRRIDFRNTLIILTSNVGSQEVINACSRQDGLPNIETLTQQLRQPLLRAFPAALLGR
LTVLPFLSLSDEMLENIVQLQLARVAQRLRENHGIAAQFDHRVTRQIMSCCMEQESGARRIDSIITNTLL
PQISRKLLTATIENQHYSQLQVTWEETAFQCHFC
 
Nucleotide Sequence: 2625 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c4409386-4406762 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGCCAGATATCAATCGCCAGTCACTATTTAATAAACTTAATCCGCCCTTGTTTAGTGCTTTGGAAAGCG
CCAGTGCATTTTGTAAGCTACGGGGCAATCCTTATGTTGAACTGGCGCACTGGTTGCATCAGCTAATGCA
GCAGAAAGCGGGCGATCTACAACAGATCATGGGCCATTTTGCCTTGGATGAGCAGCAGGTGGCACGGGAT
ATTGTGCAAGCGCTGGATATGTTACCGCGTGGAGCGAGCGCGATTTCTGATCTTTCTGCACATATTGACG
AGGCAGTAGAACGGGCTTGGGTGTGTAGTTCTGTGACCTTTGCGGCAGGTGAAATTCGTGGTGCTCACCT
GTTGCTGGCCCTGTTGACGACTTTTAATCTGCGCCAGCATTTGTTAGCTATTTCCGCTCAGTTTGCCCGT
ATTAATGCGGGAAGTTTGGCGCAGGATTTTACTCATATCCTGAGCAACAGTACGGAAAATGGTCCTCAGA
GAACGCAGGCAGAGAATGGGAATAATCAGTCAACATCAGAGAGTGCGTTACAAAATTATGCGCAGGATAT
GACTGCACTCGCGAGGGATGGGCGAATTGATCCTGTTGTTGGTCGGGATAAAGAGATTCGCCAATTGGTT
GATATTCTGCTACGCCGTCGGCAAAACAATCCTTTGATTACTGGTGAGGCTGGCGTGGGTAAAACGGCGC
TGGTGGAAGGATTGGCATTGCGTATTGCATCGGGTGATTTGCCGCCGTCATTGTGTCATGTTCAGCTTTG
GTCATTGGATATTGGCCGTTTGGAAGCGGGCGCTGGCATGAAAGGAGAATTTGAGGCACGTTTGCAAGCG
GTGATTAATGAAGTTCAGCAAAGCCCGGTTCCCATTATTCTGTTTATTGATGAGATACATATGCTAATTG
GTGCGGGCGGTGCGCAAGGAGTTGGTGACGCCGCGAATTTGTTAAAACCGGCTCTGGCGCGTGGACAGTT
GCGGACTATTGGTGCCACCACCTGGGCGGAATACAAAAAGCATATTGAAAAAGATCCGGCGCTGACCCGG
CGTTTCCAGGTATTACAGGTCGAACAGCCAGACGAAGCGCTAGCTTTACAAATGATACGGAGTTTGTCTG
GGCAACTGGAACAGCATCATGGTGTGTTATTACTGGACGAGGCGCTGGAAGCGGCGGTATCGCTCTCTCA
TCGTTATATTCCGGCTCGCCAATTGCCTGATAAAGCCATAGCTTTGCTTGATACCACCTGTGCACGGGTC
GCGGTTAGCCAGCACAGTCAACCGGCGGTATTGGAGGATTATCGCCGTCAGCTTGATGCACTCCAAATTG
AATATGAGATTGTTTGCCGCGAGCAGCAACTGGGGGGGGATCATGATGCACGCTTGGCTCAGCTTGATGA
GCAGCGCGGTGAATTGCGGGCGGAGGAAGAACTGATGGTTCAACGTTGGCAGGCTGAAATAGCACTAGCT
CAGCAGATTATCAGCTTGCGCCAACAACTGATTGCTAATGATGAAACTGCGGTAGATGATGCACAGCGTC
TGGCCTGGCAGACACAGTTACAGGATTGTCGGCAACAATTGAGTTTGTTGCAGGGAGAACAGCCATTAAT
CACGGTGGCGGTGGATGCGCACAGTGTTGCGGCGGTGGTTGCGGATTGGACCGGCATCCCGCTTGGTCGG
ATGGTAAAAAATGAGCTCAATGTTGTTCAGAATCTGGAACACAGCTTAGGGCAACGGGTTATTGGTCAGC
AATACGCGCTAAATATCATCAGTGAGCGGGTGCGGACAGCGCGTGCACATTTGGCTGATCCTAGTAGACC
GGTGGGAGTATTTCTGCTGTGTGGTCCTTCTGGAGTCGGGAAGACCGAAACGGCATTAGCACTTGCTGAG
AGCCTATATGGTGGTGAACAGAATCTGATTACCATCAATATGAGTGAGTTTCAGGAGCCACACAGCGTAT
CAACTCTGAAAGGGGCGCCACCGGGATATGTTGGTTATGGTGAAGGTGGAGTCTTAACAGAAGCGGTTCG
GCGACGCCCATACAGTTTGGTGTTGCTTGATGAGGTGGAAAAAGCCCATTCTGATGTGCATGAACTGTTT
TTTCAGGTATTCGATAAAGGCTGGATGGAAGATGGTGAAGGTCGGCGCATTGATTTCCGTAATACACTGA
TCATATTGACCTCGAATGTGGGTAGTCAGGAAGTTATCAACGCTTGTAGCCGGCAGGATGGTTTGCCGAA
TATAGAAACGTTGACACAGCAGTTACGCCAACCGTTGTTACGGGCTTTTCCTGCCGCACTGCTTGGCCGT
TTGACGGTTCTTCCTTTTTTATCATTGAGTGACGAAATGTTGGAAAATATTGTGCAATTGCAGCTGGCGC
GGGTGGCACAACGTTTGCGGGAAAATCATGGTATTGCAGCGCAGTTTGACCACCGAGTGACGCGACAGAT
TATGTCCTGTTGTATGGAACAGGAATCTGGTGCTCGCAGGATTGATTCGATTATTACGAATACTTTATTA
CCGCAAATTAGTCGTAAGTTGCTGACCGCAACAATAGAGAATCAGCATTATTCACAATTGCAGGTAACTT
GGGAGGAGACGGCGTTTCAGTGTCATTTTTGCTGA
 Primer design

Protein ID: 253991305
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03832
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4454078..4456756 [-]
ProductClpA/B-type chaperone
NoteTssH
UniProt IDC7BMP1
KEGG IDpay:PAU_03832
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.20E-40, Aligned region: 238..257
AAA_2 [PF07724], Evalue: 1.20E-40, Aligned region: 613..778
AAA [PF00004], Evalue: 1.40E-19, Aligned region: 26..80
AAA [PF00004], Evalue: 1.40E-19, Aligned region: 240..351
AAA [PF00004], Evalue: 1.40E-19, Aligned region: 618..736
AAA [PF00004], Evalue: 1.40E-19, Aligned region: 766..783
AAA_5 [PF07728], Evalue: 2.20E-14, Aligned region: 240..260
AAA_5 [PF07728], Evalue: 2.20E-14, Aligned region: 617..737
ClpB_D2-small [PF10431], Evalue: 1.10E-13, Aligned region: 784..858
AAA_16 [PF13191], Evalue: 3.70E-12, Aligned region: 115..198
AAA_16 [PF13191], Evalue: 3.70E-12, Aligned region: 217..261
AAA_16 [PF13191], Evalue: 3.70E-12, Aligned region: 285..318
AAA_16 [PF13191], Evalue: 3.70E-12, Aligned region: 447..479
AAA_16 [PF13191], Evalue: 3.70E-12, Aligned region: 598..653
AAA_16 [PF13191], Evalue: 3.70E-12, Aligned region: 681..712
AAA_16 [PF13191], Evalue: 3.70E-12, Aligned region: 756..865
AAA_22 [PF13401], Evalue: 7.60E-10, Aligned region: 61..95
AAA_22 [PF13401], Evalue: 7.60E-10, Aligned region: 239..334
AAA_22 [PF13401], Evalue: 7.60E-10, Aligned region: 616..711
AAA_25 [PF13481], Evalue: 5.10E-09, Aligned region: 240..316
AAA_25 [PF13481], Evalue: 5.10E-09, Aligned region: 615..646
NACHT [PF05729], Evalue: 1.50E-06, Aligned region: 240..343
NACHT [PF05729], Evalue: 1.50E-06, Aligned region: 617..638
Arch_ATPase [PF01637], Evalue: 1.60E-06, Aligned region: 218..254
Arch_ATPase [PF01637], Evalue: 1.60E-06, Aligned region: 292..389
Arch_ATPase [PF01637], Evalue: 1.60E-06, Aligned region: 611..630
Arch_ATPase [PF01637], Evalue: 1.60E-06, Aligned region: 688..703
IstB_IS21 [PF01695], Evalue: 3.30E-06, Aligned region: 234..301
IstB_IS21 [PF01695], Evalue: 3.30E-06, Aligned region: 617..635
IstB_IS21 [PF01695], Evalue: 3.30E-06, Aligned region: 846..860
AAA_19 [PF13245], Evalue: 5.50E-06, Aligned region: 237..260
AAA_19 [PF13245], Evalue: 5.50E-06, Aligned region: 615..645
AAA_17 [PF13207], Evalue: 6.80E-06, Aligned region: 240..355
AAA_17 [PF13207], Evalue: 6.80E-06, Aligned region: 616..652
Clp_N [PF02861], Evalue: 1.80E-05, Aligned region: 23..57
Clp_N [PF02861], Evalue: 1.80E-05, Aligned region: 103..124
Zeta_toxin [PF06414], Evalue: 4.80E-05, Aligned region: 235..261
Zeta_toxin [PF06414], Evalue: 4.80E-05, Aligned region: 604..657
AAA_14 [PF13173], Evalue: 7.20E-05, Aligned region: 240..343
AAA_14 [PF13173], Evalue: 7.20E-05, Aligned region: 616..707
Sigma54_activat [PF00158], Evalue: 9.80E-05, Aligned region: 222..254
Sigma54_activat [PF00158], Evalue: 9.80E-05, Aligned region: 616..734
AAA_18 [PF13238], Evalue: 0.00098, Aligned region: 240..267
AAA_18 [PF13238], Evalue: 0.00098, Aligned region: 618..638
AAA_23 [PF13476], Evalue: 0.0023, Aligned region: 240..533
AAA_23 [PF13476], Evalue: 0.0023, Aligned region: 615..641
AAA_29 [PF13555], Evalue: 0.0035, Aligned region: 234..256
AAA_29 [PF13555], Evalue: 0.0035, Aligned region: 615..630
DUF258 [PF03193], Evalue: 0.0042, Aligned region: 228..257
DUF258 [PF03193], Evalue: 0.0042, Aligned region: 617..629
RNA_helicase [PF00910], Evalue: 0.0059, Aligned region: 241..261
RNA_helicase [PF00910], Evalue: 0.0059, Aligned region: 618..638
RNA_helicase [PF00910], Evalue: 0.0059, Aligned region: 715..736
Protein Sequence: 892 a.a.     [Download]
>gi|253991305|ref|YP_003042661.1| ClpA/B-type chaperone [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MDTVSTSLLCRLNPYCAQALSAAAALCQTRAHAEITVEHWLLKLLEDGEGDITVIARRYEWDMHSLWQSL
LTTIDRLPRSINQRPRLSDSLYRLLQVAEFVASQEAGNESIRSVHLLQVLRGQPDWLRTHDGWPLMSLSV
SQLQHLRPLLDQHSAERPEVQAAARLADSGGGSAVAEIHPDKPAQNAQALSPALQGVLDKFTLDLTARAA
EGRIDPVFGRDNEIRQMIDILSRRRKNNPILVGEPGVGKTALVEGLALRIAGGQVPDSLKTVSVRSLDLG
LLQAGAGVKGEFEQRLKNVIEAVQQSPTPILLFIDEAHTLIGSGNQAGGTDAANLLKPALARGALRTIAA
TTWSEYKQYFERDAALERRFQMIKVDEPDDETACLMLRGLKARYARYHGVHIQDNAVKAAVTLSRRYLTG
RQLPDKAVDLLDTASARVRMSLDTVPEALTQRQAQLTALEMEQQAIEADSAVLPTEEDNTRLKEIAVRRE
EVARQTEQLTAQYQREKSLAQRLLDLRQHSPKTPELREGIAELAELQGNEPLLSLNVDVRTVATVVADWT
GIPLSSLLKDEQTGLLHLEQYLGDRVIGQDMALREIAQRLRAAKTGLTPEQGPLGVFLLVGPSGVGKTET
ALALADCLFGGERSLITINLSEYQEPHTVSQLKGSPPGYVGYGQGGILTEAVRQRPYSVVLLDEVEKAHR
DVLNLFYQVFDRGFMRDGEGREIDFRHTVILMTSNLGSDQLMALLAQQPDAPTATQHELLRPILRDHFQP
ALLARFQTVIYRPLSAEALRRIVDIKLGQVTRRLNTHYGLTCTVESGLCDTLVNACLLPDSGARNIDSLL
NQQILPVLSQALLERLAHHHKPVGVTLGFNEEEGIILAFTEQTAVSDSGENA
 
Nucleotide Sequence: 2679 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c4456756-4454078 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGGATACGGTATCGACTTCATTATTGTGTCGCTTAAATCCCTATTGCGCACAGGCACTAAGCGCAGCAG
CAGCACTCTGCCAGACACGAGCGCATGCTGAAATTACTGTGGAGCACTGGTTGCTAAAACTACTTGAAGA
CGGTGAGGGCGATATTACTGTGATTGCCCGGCGTTACGAGTGGGATATGCATTCGTTGTGGCAATCTTTG
TTGACCACGATTGACCGTCTGCCCCGTAGCATCAATCAACGTCCACGGTTGTCAGATAGCTTGTATCGTT
TATTACAAGTCGCTGAGTTTGTTGCTTCTCAAGAAGCAGGCAATGAATCTATTCGCTCGGTGCATTTGTT
GCAGGTGCTGCGTGGTCAGCCGGATTGGTTGCGTACTCACGATGGTTGGCCGTTGATGAGCCTGAGTGTG
AGCCAGTTACAACATTTGCGCCCGCTGCTGGATCAGCATTCAGCAGAGCGCCCGGAAGTACAGGCGGCGG
CGCGTCTGGCCGATAGCGGCGGGGGTTCTGCGGTGGCAGAAATACATCCTGATAAACCTGCTCAAAATGC
TCAAGCGTTATCACCAGCGTTACAGGGAGTATTAGACAAATTCACACTGGATTTAACGGCGCGTGCTGCC
GAGGGCCGTATTGATCCGGTGTTTGGTCGTGACAATGAAATTCGCCAAATGATCGACATTCTGTCGCGCA
GACGTAAAAACAACCCAATTTTGGTCGGTGAACCGGGGGTAGGAAAAACTGCGCTGGTGGAAGGATTGGC
CTTGCGTATTGCCGGTGGTCAGGTGCCTGATAGCCTGAAAACCGTCAGTGTGCGGTCGCTGGATCTGGGG
CTATTGCAGGCAGGCGCGGGGGTAAAAGGCGAATTTGAACAACGGCTGAAAAACGTGATTGAAGCAGTAC
AACAGTCACCCACCCCAATCTTACTGTTTATTGATGAAGCTCATACGCTGATTGGCTCTGGTAATCAGGC
AGGCGGCACCGATGCGGCTAACCTGCTCAAACCCGCACTGGCGCGGGGAGCATTACGCACGATTGCCGCC
ACTACCTGGTCGGAATACAAACAATATTTTGAGCGGGATGCGGCACTGGAACGGCGTTTTCAGATGATCA
AAGTGGACGAACCGGATGATGAAACCGCCTGCCTGATGCTGCGTGGTCTGAAAGCGCGCTATGCCCGTTA
CCATGGCGTTCATATTCAGGATAACGCCGTTAAAGCAGCGGTTACCTTATCTCGCCGTTACCTGACCGGG
CGTCAGCTCCCGGATAAAGCAGTGGATTTGCTGGATACCGCCAGCGCCCGGGTGCGGATGAGTCTGGATA
CGGTGCCGGAAGCATTGACGCAACGTCAGGCACAACTAACGGCCCTTGAAATGGAGCAACAGGCGATTGA
AGCGGATTCGGCGGTGTTGCCGACAGAAGAAGATAACACCCGTTTAAAGGAGATTGCGGTTCGGCGTGAA
GAGGTTGCACGCCAGACTGAACAACTCACAGCACAGTATCAGCGCGAAAAGAGCCTGGCTCAGCGCCTTC
TCGATTTACGTCAACATTCACCCAAAACACCTGAACTCAGGGAAGGCATAGCGGAGCTGGCAGAATTACA
GGGCAATGAGCCATTACTTTCATTGAATGTCGATGTGCGTACTGTCGCGACGGTCGTTGCCGATTGGACG
GGGATACCGTTAAGCAGTTTGCTAAAAGACGAACAAACCGGTTTGTTACATCTTGAGCAGTATTTAGGCG
ACCGGGTTATCGGTCAGGATATGGCACTGAGGGAAATCGCTCAACGTTTACGTGCGGCTAAAACCGGTTT
GACGCCGGAACAGGGGCCATTAGGCGTCTTTCTACTGGTGGGGCCAAGTGGTGTGGGGAAAACCGAAACC
GCACTGGCATTGGCCGATTGCCTGTTTGGGGGCGAACGTTCACTAATTACTATCAATTTGTCGGAATATC
AGGAACCGCATACGGTTTCTCAGCTGAAAGGTTCACCTCCGGGTTATGTGGGGTACGGACAGGGCGGCAT
TTTGACGGAAGCAGTACGTCAGCGCCCCTACAGCGTCGTGTTGTTGGATGAAGTAGAAAAAGCGCATCGT
GACGTGTTGAACCTGTTCTATCAGGTATTTGATCGCGGTTTTATGCGGGATGGTGAAGGGCGCGAGATCG
ATTTTCGTCATACCGTCATATTGATGACCTCTAATCTGGGGAGTGATCAACTGATGGCATTATTGGCACA
ACAGCCTGATGCTCCGACTGCCACCCAGCACGAATTGTTGCGTCCCATACTGCGTGATCACTTTCAGCCG
GCATTGTTGGCTCGTTTCCAGACCGTGATTTACCGCCCATTATCGGCGGAAGCGCTCAGACGGATTGTAG
ACATCAAATTGGGGCAAGTCACCCGGCGTCTAAACACCCATTATGGCCTGACCTGCACGGTGGAAAGTGG
CCTGTGCGACACGCTGGTCAATGCCTGTCTGTTGCCGGACAGTGGGGCGCGCAATATCGACAGCCTGCTC
AATCAACAAATCTTACCGGTGCTATCGCAGGCGCTGCTAGAACGTCTGGCACATCACCATAAACCTGTTG
GCGTAACGTTAGGTTTCAATGAAGAAGAGGGGATCATCCTTGCTTTCACTGAACAGACTGCCGTATCTGA
TAGCGGGGAAAATGCATGA
 Primer design