SecReT6
Protein ID: 253991272
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03799
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4409439..4410530 [-]
Producthypothetical protein
NoteTssG
UniProt IDB6VLB3
KEGG IDpay:PAU_03799
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.60E-89, Aligned region: 36..344
Protein Sequence: 363 a.a.     [Download]
>gi|253991272|ref|YP_003042628.1| hypothetical protein PAU_03799 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MKIFAIHADNQIVQVGEKIQTVSSALDIHFWAEKEKTPWDFDLFQLLRRIDAQSGAPYSLGRSPLPRYEP
LRLGQQPTLCFAPAEIASIEPCPDGARYQININNFGLFGPNGPLPLHVTEFAWQRQKQHKDHALSAFFNL
FQHRLITLFWRAWADAQPCLSFDRSDNRRFDRFFASFIGMEHISSYRLRQERTHHYMAGHLSRYPRNKEG
LLCLLRYHFGLPVTLHENQFHWLAIARDEQLQLHNRHSGARLGCAIRLGIAVADVQYAFCLELGPLSWSA
YQRFLPASRFATSCCDDLQQLCDWVRGYVGLEYAWKLRITLDHQHYQGCSLGSTQSLGQNCWLGLNIHHH
DRSDLCFNPDKAA
 
Nucleotide Sequence: 1092 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c4410530-4409439 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGAAGATATTTGCCATACATGCCGACAATCAGATCGTACAGGTTGGGGAAAAAATACAGACAGTATCAT
CCGCTCTTGATATTCATTTCTGGGCTGAAAAAGAAAAAACGCCGTGGGATTTTGATCTGTTTCAATTGCT
ACGGCGTATTGATGCACAGTCAGGAGCGCCCTATTCCTTGGGACGTTCACCTTTACCGCGTTATGAACCA
TTGCGCTTGGGGCAACAGCCGACATTGTGCTTTGCACCGGCAGAAATTGCGTCCATTGAGCCTTGCCCCG
ATGGTGCTCGCTATCAGATTAATATCAATAACTTTGGTCTGTTTGGCCCGAATGGACCTCTACCTCTACA
TGTTACTGAGTTTGCCTGGCAACGTCAGAAACAACATAAAGATCATGCATTGAGTGCCTTTTTTAACCTT
TTTCAGCATCGTTTAATAACCTTATTTTGGCGTGCATGGGCAGACGCACAGCCTTGTCTTTCCTTTGATC
GCAGCGATAACCGCCGCTTTGATCGCTTTTTTGCTAGCTTTATCGGCATGGAACACATTTCGAGTTACCG
CCTCCGGCAGGAACGGACACATCACTATATGGCTGGGCACTTGAGCCGCTATCCGCGTAATAAAGAGGGT
TTGCTGTGCTTGCTACGTTACCATTTTGGTTTACCAGTGACGTTACATGAAAACCAGTTTCATTGGTTAG
CGATTGCTCGTGATGAGCAGTTACAGCTGCATAACCGGCATTCAGGTGCCCGGTTGGGGTGCGCAATCCG
TCTCGGTATTGCTGTAGCTGATGTGCAATATGCATTTTGTCTGGAACTTGGTCCGCTCTCCTGGTCGGCA
TATCAGCGTTTCTTACCGGCTTCACGATTCGCAACATCCTGTTGTGATGATCTTCAGCAATTGTGTGATT
GGGTTCGGGGTTATGTCGGCCTTGAATATGCCTGGAAACTCAGAATTACGTTGGATCATCAGCATTATCA
GGGCTGTTCATTAGGTAGCACTCAGTCTTTGGGGCAAAACTGTTGGCTGGGACTTAACATCCATCATCAC
GATCGTAGCGATCTCTGTTTCAATCCAGATAAGGCTGCGTAG
 Primer design