SecReT6
Protein ID: 253991273
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03800
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4410527..4412395 [-]
Producthypothetical protein
NoteTssF
UniProt IDB6VLB4
KEGG IDpay:PAU_03800
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.10E-194, Aligned region: 5..622
Protein Sequence: 622 a.a.     [Download]
>gi|253991273|ref|YP_003042629.1| hypothetical protein PAU_03800 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MHEKLLEYYNRELAWLREMGGEFARHYPGVAGRLGMQGDDVTDPYVERLMEGVAFLTSRIQLKMDAEFPR
FSAQLLEALYPNYLAGLPSMAIVELQPDPTKGDLSKGFPVPRGSLMESLALKKKGLNCCYRTAQDVTLQP
LRLLQVELGGVPADIPLAALGGANVQGALRIQLSCFDNVSLGELQCDELMFYLSGGDIPALQLLELLMAH
GQGVLCQIPGSSVQRLLLPSQVLRHEGFASEQALLPVDLRNVEAYRLLQEYFAFPARFQFFSISGLQPLL
AQAGKQQRLEIQILLDVRSPQLEKVVDVSHLALHCTPAINLFPRTAEPMILNEQQHEYHVVVDNMRPLDY
EVFSVTALRGIGTQHDGDQRYIFHPLYHTQHDDALVNAGYFSIRRESRLLPQDVNRYGMRSDYLGSEVYV
ALADEHHPPWRSDLKYLSAEVLCTNRDLPLLLQRQAQESLVMQDSVPVSGVQLRKGPSNPRPALAESRIC
WQLINQLQLNYFSLQDCTTEQGETELRRLLRFHASQADAVIAQQINGIRCCRLQAQNRHMTGTPLFQRGV
NVALEVDEQAFSGRSPWLMGSVLAHLFSRLVTINSFAETTLSSVQRGTIGFWSGRGGVRTLL
 
Nucleotide Sequence: 1869 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c4412395-4410527 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGCATGAAAAATTACTGGAATATTACAATCGTGAGTTGGCATGGCTGCGTGAAATGGGGGGAGAATTTG
CTCGCCATTATCCTGGGGTTGCCGGGAGATTGGGAATGCAGGGGGATGACGTTACCGATCCTTACGTTGA
GCGTTTGATGGAAGGTGTTGCTTTTTTGACTTCGCGCATTCAACTCAAAATGGATGCTGAATTTCCGCGT
TTCTCTGCTCAGTTATTGGAAGCCCTTTACCCTAACTACCTTGCTGGTCTGCCTTCGATGGCAATTGTTG
AATTACAGCCAGATCCGACTAAAGGGGATTTGAGTAAAGGTTTTCCTGTGCCTCGTGGTTCTCTGATGGA
GAGTTTGGCACTGAAAAAGAAGGGGCTCAACTGTTGCTACCGTACAGCGCAAGATGTCACCTTACAACCG
TTGCGTTTGCTACAGGTTGAATTGGGTGGTGTTCCTGCGGATATTCCGCTTGCTGCGCTTGGCGGTGCGA
ATGTACAGGGTGCTTTGCGTATTCAGTTATCGTGTTTTGATAATGTGTCGTTGGGCGAATTGCAATGTGA
TGAGCTGATGTTTTATCTCAGTGGCGGCGATATTCCCGCGTTGCAACTGCTGGAATTATTGATGGCACAC
GGTCAGGGCGTGTTGTGCCAAATTCCCGGCAGTTCAGTGCAGCGGTTATTGCTGCCATCTCAGGTATTGC
GTCATGAGGGTTTTGCTTCTGAACAGGCATTGTTGCCGGTTGATTTGCGTAATGTAGAAGCTTATCGCCT
GTTGCAGGAATATTTTGCTTTTCCTGCCCGTTTCCAGTTTTTCAGTATCAGTGGCTTACAGCCGCTGTTG
GCGCAAGCCGGTAAACAACAGAGATTAGAAATTCAGATCTTGCTAGATGTGCGTTCGCCACAGTTGGAAA
AGGTGGTGGATGTCAGCCATCTGGCTTTGCATTGTACTCCTGCTATTAACCTTTTCCCTCGTACTGCTGA
GCCGATGATACTTAATGAACAACAGCATGAATATCATGTTGTGGTTGATAACATGCGTCCGCTTGATTAT
GAGGTTTTTTCTGTCACAGCATTACGCGGTATTGGTACTCAGCATGACGGCGACCAGCGCTATATTTTCC
ATCCGCTTTATCATACGCAGCATGATGATGCGTTGGTTAATGCGGGATATTTTTCTATCCGCCGTGAATC
TCGTCTGTTGCCACAGGATGTAAACCGCTATGGTATGCGCTCTGATTATCTTGGCAGTGAGGTTTATGTT
GCGCTGGCAGACGAGCATCACCCGCCTTGGCGTAGTGATTTGAAATATCTCAGTGCAGAAGTTTTGTGTA
CCAACCGTGATCTTCCTTTATTGCTACAACGTCAGGCTCAAGAAAGCTTGGTGATGCAGGATTCGGTACC
TGTTTCTGGTGTTCAGTTACGTAAAGGTCCCAGCAATCCCCGTCCGGCATTGGCAGAGAGTCGTATCTGT
TGGCAGCTAATCAATCAGTTACAACTTAACTACTTTAGCTTGCAGGATTGCACCACTGAACAGGGTGAAA
CAGAACTACGGCGGCTGTTGCGTTTTCATGCGAGTCAGGCAGATGCGGTGATTGCGCAGCAGATTAACGG
TATCCGTTGTTGTCGCTTGCAGGCTCAAAATCGTCATATGACCGGTACACCGTTATTTCAGCGCGGTGTC
AACGTGGCGTTGGAGGTAGATGAACAGGCATTTTCTGGTCGTTCTCCTTGGTTAATGGGGAGCGTATTGG
CGCATCTGTTTAGCCGTTTGGTGACAATAAACAGTTTTGCGGAAACAACGCTCTCCAGTGTGCAACGGGG
GACGATCGGATTTTGGTCGGGACGTGGTGGGGTAAGGACATTGTTATGA
 Primer design