SecReT6
Protein ID: 253991274
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03801
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4412399..4412935 [-]
Producthypothetical protein
NoteTssE
UniProt IDB6VLB5
KEGG IDpay:PAU_03801
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.90E-15, Aligned region: 47..155
Protein Sequence: 178 a.a.     [Download]
>gi|253991274|ref|YP_003042630.1| hypothetical protein PAU_03801 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MMSRIPEKNVRERRVPAVYANHQTFPMLLERLTESGNDREDGLYGDSAQQLRLSVLHNLQALLNCDHYSS
GADLSSWPHVSTSTLNFGIRALAGKFVSQVSWESIECAIREAILHFEPRIMPQELTITGMQGDQKLNAHN
ILCFEIRGHLLCSSRPLAFAFSSHVDLENGRFELVDGG
 
Nucleotide Sequence: 537 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c4412935-4412399 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGATGAGCAGAATACCAGAGAAAAACGTCAGGGAACGTAGAGTGCCGGCAGTCTATGCTAATCATCAGA
CGTTTCCCATGTTACTCGAACGTCTGACAGAGAGCGGAAATGATCGGGAAGATGGGTTGTATGGTGACAG
TGCACAGCAGCTTCGTCTGTCGGTTCTGCATAATTTACAGGCTCTACTTAATTGCGACCATTATTCCTCT
GGCGCCGATCTTTCATCATGGCCGCATGTCAGCACCAGCACACTGAATTTCGGTATTCGTGCATTGGCTG
GCAAGTTTGTTTCTCAGGTGAGCTGGGAAAGTATTGAGTGCGCGATACGTGAAGCTATTCTTCATTTTGA
ACCACGTATTATGCCACAGGAATTAACCATCACGGGTATGCAGGGTGATCAAAAATTGAATGCGCACAAT
ATTCTCTGCTTTGAAATCCGGGGGCATCTGTTGTGTTCTTCCCGCCCATTGGCATTTGCTTTCAGTAGTC
ATGTTGATCTGGAAAATGGCCGTTTTGAGCTGGTGGATGGAGGGTAA
 Primer design