SecReT6
Protein ID: 253991278
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03805
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4417242..4419743 [-]
Producthypothetical protein
NoteTssI
UniProt IDB6VLB9
KEGG IDpay:PAU_03805
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.30E-73, Aligned region: 36..337
Phage_base_V [PF04717], Evalue: 3.30E-24, Aligned region: 382..475
Gp5_C [PF06715], Evalue: 0.0055, Aligned region: 518..539
Gp5_C [PF06715], Evalue: 0.0055, Aligned region: 699..717
MCC-bdg_PDZ [PF10506], Evalue: 0.0075, Aligned region: 786..826
Protein Sequence: 833 a.a.     [Download]
>gi|253991278|ref|YP_003042634.1| hypothetical protein PAU_03805 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MSHRSDYRTDVRIIANIPRNVSDSDKLRFRKLTGSESLSQLYQFKVEFLCPCNDLDMKSLLGKSMSLEIP
LIQGGSRFLHGNITRIEYAGHYLQEGRDKLYIFTLHPSLWYLTQNRDCHIWQGQSVPDIIAGLLAKYNIN
IENRLSSHYRQWEYCVQYQESDFDFISRLMEHEGIYYYFSHQKEGHTLILADSPNAHRPFNDAYAQIRYL
AAQPGVVDHQEGITCWNTAQEITPRIYTLDDYDFRKPRAHLLEVCRNPASFAANKADVFEWPGRYIDNQH
GQFYAQIRQQAFKAQQQQMYGNATACGVAPGSTFTLQNSPFPADSDAFLVTHVEYELYDCTLYDELDQGN
QDKGPFQATFRAVPADIVWRPQRITPWPKTCGPQTAEVTGPAGESIWTDKYGRVKLKFRWDRYSQPDDRS
SCWVRVSSSWAGWKYGSLQIPRIGEEVVVDFINGDPDRPLVTGRVYNEECMPPWQLPDDATRMGFMSRSK
KGGVDNASFLFLEDAPGRESFTMHAERDMNISVEHDKNITVDGALAQEIKGETHFKHYGVCNTLKMMPDI
QTFLLGKTAVIGVGGRADFIAGGRYERIQGKSETQVNQSISQHAGENISCHARGNILFDAGKQIIYGDSL
YLNKESSDPNNQAEKKLMTLQGLTPEEIADQKASEQQQQQKIPTSVIYKKGVSVEINGVDNRRVDKDQKV
EIKGAVTRSIDGSWQEHVKDDLKIQADADAHLNCGGKVCIETKDMEHKIEGHIETHAGNTLTVCGTTESI
NMLNYTNSSIAMKNEGVVMSNNMLNIGNTTLHMSTNTLSLSLGQININAVALSLSLSGLAIFI
 
Nucleotide Sequence: 2502 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c4419743-4417242 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGAGTCATAGATCCGATTATCGTACAGATGTCCGCATTATTGCGAATATACCGCGTAATGTTTCTGATA
GCGATAAACTGCGTTTCAGAAAATTAACGGGTAGTGAATCGTTGTCGCAACTGTATCAGTTTAAAGTGGA
GTTTCTCTGTCCATGTAATGATCTCGATATGAAGTCATTGTTGGGTAAGAGTATGTCTCTGGAGATACCA
TTGATACAGGGTGGTTCCCGTTTCTTGCATGGTAATATTACGCGTATTGAATATGCCGGACATTATTTGC
AGGAAGGTAGGGATAAATTATATATCTTCACCTTACATCCTTCTCTCTGGTATTTGACGCAAAACCGTGA
TTGTCATATTTGGCAGGGACAGAGCGTGCCGGATATTATTGCTGGCCTGCTTGCAAAATATAATATCAAT
ATTGAAAACCGTCTCAGTAGCCATTATCGCCAATGGGAGTATTGCGTTCAATATCAGGAGAGTGATTTTG
ACTTTATTAGTCGATTAATGGAGCATGAAGGTATCTATTATTATTTCAGTCATCAGAAAGAGGGGCATAC
CTTAATTTTGGCTGATTCCCCCAATGCGCATCGGCCATTTAATGATGCTTATGCTCAAATTCGTTATTTA
GCGGCACAACCGGGTGTTGTTGATCATCAGGAGGGGATTACCTGCTGGAATACGGCCCAGGAAATTACGC
CACGAATTTATACGCTAGATGATTATGATTTTCGTAAACCACGGGCGCACTTATTAGAAGTATGTCGTAA
TCCAGCATCGTTTGCAGCGAATAAGGCTGATGTTTTCGAATGGCCAGGACGTTATATCGACAATCAACAC
GGCCAGTTTTATGCGCAAATTCGTCAACAGGCATTTAAAGCGCAGCAACAACAGATGTATGGCAATGCGA
CAGCGTGCGGAGTGGCTCCGGGCAGCACGTTTACCCTGCAAAATAGCCCTTTTCCAGCTGATTCAGACGC
TTTTCTTGTCACACATGTGGAATATGAATTGTATGACTGTACGCTGTATGACGAATTGGACCAAGGCAAT
CAGGATAAAGGGCCATTCCAGGCCACATTCCGCGCAGTGCCGGCTGATATTGTCTGGCGTCCACAACGGA
TAACACCTTGGCCGAAAACCTGTGGTCCCCAAACGGCGGAAGTTACTGGCCCGGCAGGGGAAAGCATTTG
GACCGACAAATATGGTCGTGTCAAATTGAAATTCCGTTGGGACAGATACAGTCAGCCAGATGATCGCAGC
TCTTGCTGGGTACGTGTTTCCAGTAGTTGGGCGGGTTGGAAATATGGCAGCTTGCAAATTCCACGCATCG
GTGAAGAGGTGGTGGTTGATTTTATTAACGGTGACCCGGATCGCCCGCTGGTAACTGGGCGGGTGTATAA
CGAAGAGTGTATGCCGCCCTGGCAGTTACCCGATGATGCGACCCGGATGGGCTTTATGAGCCGCAGTAAG
AAGGGTGGGGTAGATAACGCCAGTTTTCTGTTTCTCGAAGATGCTCCTGGGCGTGAGTCATTCACTATGC
ACGCTGAACGTGACATGAATATCTCCGTTGAGCACGATAAAAATATTACTGTTGATGGCGCCTTAGCGCA
GGAGATAAAAGGCGAAACCCATTTCAAGCATTATGGTGTGTGCAACACCCTGAAAATGATGCCGGATATT
CAAACCTTCCTGTTAGGGAAAACTGCCGTTATCGGTGTCGGTGGACGCGCGGATTTTATTGCGGGTGGCA
GATATGAACGTATCCAGGGTAAATCAGAGACGCAGGTCAATCAAAGTATCAGTCAACATGCCGGAGAAAA
TATCAGTTGTCATGCGCGGGGCAATATTCTGTTCGATGCGGGTAAACAAATCATCTACGGTGACAGCCTG
TATCTCAACAAAGAAAGCAGCGATCCCAATAATCAGGCAGAGAAGAAGCTGATGACGTTACAGGGGCTGA
CACCGGAGGAGATCGCGGATCAAAAAGCATCAGAGCAGCAGCAGCAGCAAAAAATTCCAACGTCAGTGAT
TTACAAGAAAGGAGTCAGTGTTGAGATCAACGGTGTTGATAACAGACGTGTGGATAAGGATCAGAAAGTA
GAAATTAAGGGCGCGGTAACGCGAAGTATTGATGGTAGCTGGCAAGAACATGTTAAAGATGACCTGAAAA
TTCAGGCAGACGCTGATGCTCATCTTAACTGTGGCGGTAAGGTGTGCATCGAAACAAAAGATATGGAGCA
TAAGATTGAAGGCCATATAGAAACCCATGCCGGCAATACCTTGACCGTTTGTGGTACGACGGAAAGTATC
AACATGCTCAATTACACCAATTCCTCTATTGCTATGAAAAATGAGGGGGTGGTGATGTCAAATAATATGC
TGAACATCGGTAATACTACGCTCCATATGTCAACCAATACCCTCAGCCTTAGCTTGGGACAGATAAATAT
CAATGCTGTGGCACTGAGTCTCAGTCTCAGCGGTTTAGCTATTTTTATCTGA
 Primer design

Protein ID: 253991304
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03831
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4451697..4454069 [-]
Producthypothetical protein
NoteTssI
UniProt IDC7BMP0
KEGG IDpay:PAU_03831
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.30E-63, Aligned region: 45..355
Phage_GPD [PF05954], Evalue: 7.30E-63, Aligned region: 591..640
DUF2345 [PF10106], Evalue: 1.20E-43, Aligned region: 554..574
DUF2345 [PF10106], Evalue: 1.20E-43, Aligned region: 614..763
T6SS_Vgr [PF13296], Evalue: 8.20E-38, Aligned region: 488..596
T6SS_Vgr [PF13296], Evalue: 8.20E-38, Aligned region: 668..682
Phage_base_V [PF04717], Evalue: 4.70E-18, Aligned region: 387..481
Protein Sequence: 790 a.a.     [Download]
>gi|253991304|ref|YP_003042660.1| hypothetical protein PAU_03831 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MVDRKTLLARQRQADKTALTGHCRYRLEVRRGEAELDVFSFSGEERLFTPYCYTIDFTSPTRDIDPAVML
KKSATFILQAPESPAQVRKVYGVITRFNRISSSVDETHYRVCLEPRLALLRHTRRCAIYQNQSVPEIVEK
VLRDRHGFRGQDFLFTLVREYPRRELVVQWQESDLDFVQRILAEVGIWYRFEADSRLGIDVVRFGDNQRN
YQYDVTLPLRNPAGMNHNAGDSVWNLHFEHQVVTQGVTVRDYNYREAESYLQCQVRQERDTTTEGEIYRY
GDHFLTLGDKFQPEVETGTFYARLHHERDRGHQHLISGQSSSPVLEPGLVLEIEGEIPASLKKGVLIIST
DSHARRDSNYLVSFMGIPYSEIISYRPALRERPVISGTVPARVTSDWPKDTYGHIDKQGRYRIKFDFDLD
DWPMGRESLWVRLARPYAGRTYGFHWPLVQGTEVAVAFEQGNPDRPYIAHALHDSRHEDHVTVYNYKRNV
LRTPANNKLRMDDERGKEHIKLSTEYGGKSQLNLGHLVDGKRPHPNKRGEGFELRTDDWGAIRAGKGLFI
SADQQTQAAGQQLDMSGALSELEAALQTAAGLRHAAEAAKAELADIETQTALMNETLKDLQQRALLLSAP
SGIAQVTPGSLQLSAGENLITTVGRDADMSITRKFRLAVGKGLSLFTRAWGIKLLAASGKVEIQAQTDAM
DVLARQALTLASQDDRVTVSAKTELRLECGGAYISLKEGQIAFASPKNARFQCDILQKTGPASQDSALTL
PERCISASARMAGDQNGVTK
 
Nucleotide Sequence: 2373 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c4454069-4451697 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGGTAGATAGAAAAACGCTGCTGGCCCGCCAGCGTCAGGCGGATAAAACAGCGCTGACGGGTCACTGCC
GTTATCGGCTTGAGGTCCGGCGCGGTGAGGCGGAGCTGGATGTGTTCAGCTTCAGTGGGGAAGAACGCCT
GTTCACCCCTTATTGTTACACCATTGATTTCACCAGTCCCACCCGGGATATCGACCCGGCGGTGATGTTG
AAAAAATCTGCCACGTTTATCTTGCAGGCACCAGAAAGCCCGGCGCAGGTGCGTAAAGTGTACGGGGTGA
TTACCCGGTTTAACCGGATTTCCAGCTCGGTGGATGAAACCCACTATCGGGTCTGTCTGGAGCCGCGTCT
GGCGTTGTTGCGCCATACCCGACGTTGTGCCATTTACCAGAATCAGTCGGTACCGGAGATTGTGGAAAAG
GTCCTGCGTGACCGGCACGGTTTTCGCGGCCAGGATTTTCTGTTCACGCTGGTGCGGGAGTATCCGCGGC
GAGAACTGGTGGTGCAGTGGCAGGAGAGCGATCTGGACTTTGTTCAACGGATTCTGGCGGAAGTGGGGAT
TTGGTATCGCTTCGAGGCGGACAGCCGGCTGGGGATTGACGTGGTGCGGTTTGGAGATAACCAGCGTAAT
TACCAATACGACGTCACGCTGCCGCTGCGTAACCCGGCGGGAATGAATCACAACGCCGGTGACTCGGTAT
GGAACTTACACTTTGAGCATCAGGTGGTGACGCAGGGGGTGACGGTCCGGGATTACAACTACCGGGAAGC
GGAGAGTTATCTGCAATGTCAGGTCAGGCAGGAGCGGGATACCACGACCGAAGGGGAGATTTACCGCTAT
GGCGACCACTTCCTGACATTAGGTGACAAGTTTCAGCCGGAGGTTGAAACTGGCACCTTCTATGCCCGGT
TGCACCATGAACGTGACCGGGGTCATCAACACCTTATCAGCGGTCAAAGTTCGTCACCGGTTTTAGAGCC
GGGTCTGGTGCTGGAAATCGAAGGCGAGATCCCGGCGTCATTGAAGAAAGGGGTACTGATCATCTCAACC
GACAGCCATGCCCGGCGGGACAGCAACTATCTGGTGAGTTTCATGGGTATCCCGTACAGCGAAATCATCA
GCTACCGGCCTGCACTGCGGGAGCGCCCGGTGATATCCGGGACCGTGCCGGCACGGGTGACCAGTGACTG
GCCGAAAGACACCTACGGTCATATCGACAAACAGGGGCGTTACCGGATCAAGTTTGATTTTGATCTGGAT
GACTGGCCGATGGGGAGAGAAAGCCTGTGGGTGCGGTTAGCCCGGCCGTATGCGGGCAGAACCTACGGTT
TCCACTGGCCGCTGGTGCAGGGGACGGAGGTGGCGGTGGCGTTTGAGCAGGGCAACCCGGACCGGCCCTA
TATTGCCCATGCGCTGCATGACTCGCGGCATGAAGATCATGTGACCGTCTACAACTACAAACGCAATGTG
CTGCGCACGCCGGCGAACAACAAATTACGGATGGACGATGAGCGGGGCAAAGAGCACATCAAACTGAGTA
CCGAATACGGGGGTAAGAGTCAGCTGAATCTGGGTCATCTGGTGGATGGAAAGAGGCCGCACCCGAATAA
ACGCGGGGAAGGATTTGAGCTGCGCACCGACGACTGGGGAGCCATCCGGGCGGGGAAAGGGCTGTTTATC
AGTGCCGATCAGCAGACCCAAGCTGCGGGCCAGCAACTGGATATGTCAGGGGCGCTGTCCGAGTTGGAGG
CGGCACTCCAGACTGCGGCAGGATTACGTCATGCCGCTGAAGCGGCGAAAGCAGAGCTGGCGGATATTGA
AACCCAAACTGCATTGATGAATGAAACCCTCAAAGATCTGCAACAACGCGCCCTGTTGCTTTCAGCGCCG
TCAGGCATTGCGCAGGTGACGCCGGGCAGTTTGCAACTCTCCGCGGGTGAGAACCTGATCACGACGGTGG
GGCGTGATGCGGATATGAGCATCACCCGGAAATTTCGGCTGGCGGTGGGGAAAGGTTTGAGTTTGTTCAC
CCGGGCTTGGGGAATAAAGCTGCTGGCGGCATCTGGCAAGGTAGAAATTCAGGCGCAGACCGATGCGATG
GATGTGCTGGCACGACAGGCATTGACTCTGGCGAGTCAGGATGACCGGGTAACGGTATCGGCAAAAACTG
AACTGAGGTTGGAGTGCGGTGGTGCCTATATCTCGCTGAAAGAGGGACAGATTGCGTTTGCCAGCCCGAA
AAATGCCCGGTTTCAGTGTGACATTTTACAGAAAACCGGTCCCGCCAGTCAGGATTCAGCCCTGACCCTG
CCTGAACGTTGTATATCAGCATCAGCGCGGATGGCCGGTGATCAAAATGGCGTGACTAAATAA
 Primer design