SecReT6
Protein ID: 253991288
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03815
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4431575..4432009 [-]
Producthypothetical protein
NoteTssE
UniProt IDB6VLC9
KEGG IDpay:PAU_03815
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.10E-17, Aligned region: 28..115
Protein Sequence: 144 a.a.     [Download]
>gi|253991288|ref|YP_003042644.1| hypothetical protein PAU_03815 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MKQLRPSLYEMLTLNFNGDLDVDQIGKREQVILSVLNNMQRILNCRAGSLTHLPDYGLPDLNTILQDLPA
SSQRLIATIEHTLLTYEPRLQQVNVTLLPQLEPAHLRYDINAELKGVGLVRFSTEFVPEGKVLIRHLRQQ
GRID
 
Nucleotide Sequence: 435 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c4432009-4431575 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGAAACAGCTGAGGCCCTCACTTTACGAAATGTTGACGCTTAACTTTAATGGAGATCTGGATGTCGATC
AGATCGGTAAGCGGGAACAGGTGATTTTATCCGTACTGAACAATATGCAACGTATCCTTAACTGTCGTGC
AGGTTCGCTCACCCATTTGCCGGATTATGGTTTGCCTGATCTCAACACGATCTTGCAAGATTTGCCTGCA
TCATCACAGCGTTTGATTGCGACGATTGAACATACGTTGTTGACTTATGAACCACGTTTGCAACAGGTCA
ATGTGACATTATTGCCACAACTTGAGCCGGCACATCTGCGTTATGACATCAATGCTGAATTAAAAGGTGT
GGGATTGGTGCGTTTCAGCACCGAATTTGTGCCGGAAGGGAAGGTATTGATCCGCCATTTACGCCAGCAA
GGGCGCATAGATTAA
 Primer design