SecReT6
Protein ID: 253991289
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03816
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4432013..4432486 [-]
Producthypothetical protein
NoteTssJ
UniProt IDB6VLD0
KEGG IDpay:PAU_03816
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.90E-37, Aligned region: 1..149
Protein Sequence: 157 a.a.     [Download]
>gi|253991289|ref|YP_003042645.1| hypothetical protein PAU_03816, partial [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
LVGCGLTQTISDGTVAVTQSIFHKQVKTLHLDFSARSALNTNDAQTPLSTVIRVYQLKDNKAFERASYAE
LLKGDSEALKADRLAQRDIRVAPKGSVMLDMPMEKAAKFVAVVGLFHTPDATNNDWRLVIRRDELDADKP
RTIELGNGKLTLNPMKE
 
Nucleotide Sequence: 474 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c4432486-4432013 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
TTAGTCGGATGCGGTCTGACGCAGACTATAAGCGACGGCACAGTAGCCGTTACTCAATCCATTTTTCATA
AGCAGGTGAAGACACTGCATCTGGATTTCAGTGCCCGTAGTGCGCTTAACACCAATGACGCGCAAACACC
GCTGAGTACGGTGATACGTGTTTATCAACTCAAAGACAACAAAGCCTTTGAGCGTGCCAGTTATGCGGAA
CTGTTGAAAGGTGACAGCGAGGCGCTTAAGGCGGATCGGCTGGCACAACGGGATATTAGGGTGGCTCCGA
AGGGGAGTGTCATGTTGGATATGCCGATGGAAAAGGCCGCGAAGTTTGTGGCGGTGGTGGGGCTGTTTCA
TACACCCGATGCCACCAATAATGACTGGCGGTTGGTGATCAGGCGTGATGAGTTGGATGCAGATAAACCG
CGTACTATCGAATTAGGTAACGGCAAATTAACATTAAATCCCATGAAGGAATAA
 Primer design