SecReT6
Protein ID: 253991290
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03817
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4432530..4433561 [-]
Producthypothetical protein
NoteTssG
UniProt IDB6VLD1
KEGG IDpay:PAU_03817
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 8.50E-84, Aligned region: 7..305
Protein Sequence: 343 a.a.     [Download]
>gi|253991290|ref|YP_003042646.1| hypothetical protein PAU_03817 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MQRLAPNIYGFNFFRFCQLLESIQDERPPLGSTISPSDDPIRFRPHPGMGFPASELRNAECDEEQLPAIR
TLFLGLYGVDSPLPTAYLDDIAQRREGYEGVTDFLDIFNHRIMTQYYRIWRKYSYPATYHPGGKDETSQC
LLGLVGLGIPGSQQQIATPVSRFLALLGTMRLPTRTAEGVIKLVELLAPLTLAKVIPHDRRRVRLTLPAR
LSCRHPVQLSQRLVLGKMGTDVNSQMRLHLYTEDTDEAQGWLPQRELHADLLVLLRVYLGWRCSVRLHLT
LPKGILPAAQLGKQRIRLGRTGVLGLKPGAPAVSGMVTINLGLYQGLLPSYQYREAENGSYQF
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c4433561-4432530 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
GTGCAGCGACTGGCGCCAAACATTTACGGTTTTAACTTTTTTCGTTTCTGTCAGTTGCTGGAAAGTATAC
AGGACGAGCGTCCGCCTTTGGGCAGTACGATTTCACCCAGTGATGATCCGATCCGTTTTCGTCCCCATCC
TGGTATGGGCTTTCCTGCCAGTGAACTGAGAAATGCGGAATGTGATGAGGAACAGCTTCCGGCAATACGT
ACCTTGTTTCTGGGTCTGTATGGCGTGGATTCACCGCTGCCTACCGCTTATCTGGACGATATTGCCCAGC
GGCGTGAAGGCTATGAAGGAGTGACCGATTTTCTGGATATTTTTAATCACCGGATAATGACCCAGTATTA
CCGTATCTGGCGTAAATACTCCTATCCAGCCACTTATCATCCGGGCGGTAAAGATGAGACATCACAGTGC
TTGCTTGGGTTGGTTGGTTTGGGCATACCGGGTAGTCAGCAACAGATTGCTACGCCGGTTTCCCGCTTTC
TGGCACTGCTTGGGACTATGCGGTTGCCCACTCGAACTGCTGAAGGGGTTATTAAGCTGGTCGAGCTGCT
GGCACCGCTGACACTGGCAAAAGTGATTCCGCATGATCGCCGGCGGGTGCGGCTGACCCTGCCGGCTCGT
CTGAGTTGCCGCCATCCCGTTCAACTCTCCCAGCGTCTGGTGTTGGGTAAGATGGGAACGGATGTTAACA
GTCAGATGAGGCTTCATCTTTATACCGAAGATACCGATGAAGCTCAGGGTTGGCTGCCGCAGCGGGAATT
GCATGCCGATCTGTTGGTACTGCTGCGTGTTTATCTGGGGTGGCGTTGCAGTGTGCGATTACATCTCACT
TTACCTAAAGGGATATTGCCAGCGGCTCAGTTGGGAAAACAGCGTATCCGGCTAGGTCGTACAGGTGTAT
TAGGATTAAAACCGGGAGCGCCGGCTGTTTCAGGCATGGTGACAATTAATCTGGGACTTTATCAAGGGCT
ATTGCCAAGTTATCAATATCGGGAGGCCGAAAATGGCAGCTATCAATTTTAA
 Primer design