SecReT6
Protein ID: 253991291
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03818
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4433561..4435321 [-]
Producthypothetical protein
NoteTssF
UniProt IDB6VLD2
KEGG IDpay:PAU_03818
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.20E-185, Aligned region: 6..583
Protein Sequence: 586 a.a.     [Download]
>gi|253991291|ref|YP_003042647.1| hypothetical protein PAU_03818 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MDDLILRYYEAEMHYLREAGKEFALAHPDRAAMLNLDEGHDLDPYVERLLEGFAFLMGRMRQKLDDSLPE
LTEGLVSLLWPHYMRTIPSLSIVELAPDYQDLQRSESIAKGFEVVSQPVGPSQTRCYYRTTRDMCITPLH
ITSATLQNETDGRSVIRLRFDCGQLAEWDKVDLTRLPLYLKAGSPLSSALHLALTRQTQDIYVRVSGMER
RRFEGHFSPMGFDSDDVLWPKGESAFSGYQLLLEYFTFREKFMFVALNGLETLHIPASTPWFELEMVLGE
LWPYELPFSAENIRLHCVPVINLFNVEADPMHISRMQNEYLLRPMRIQDGHTEIYSVDEVLSSGRGETQR
FVPFSSFRHRGGIMRNAAPERYYHTRVCPNPAGLHDTWLILGGESFESDPEIDDETLSLRITGTNGQLPR
RALRDTQLEQTLQSTGGKLRVKNLCSPTLPCYPPANDRFHWRVLSHLGSNFLSMMDNPEVLRGTLGLYNW
TNDEMNCRRLDAIVGVKHSLIQRFEKGYLLRGVDIEITLNSNGFSGEGDIFLFGEMLNRFFSLYTDIHLF
NQLTLVLQPSEKCLRWKENHNQRIPG
 
Nucleotide Sequence: 1761 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c4435321-4433561 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGGATGATTTAATTCTCCGCTATTACGAGGCGGAAATGCACTATCTGCGTGAGGCAGGTAAAGAATTTG
CGTTGGCGCATCCAGATCGGGCGGCAATGCTTAATCTGGACGAGGGACATGATCTTGATCCCTATGTGGA
ACGGTTACTTGAAGGCTTTGCGTTCCTGATGGGCCGGATGCGGCAAAAACTTGACGATAGTTTGCCGGAG
CTGACAGAAGGGTTGGTTAGCCTGCTGTGGCCGCATTATATGCGTACCATTCCCTCACTCTCTATTGTTG
AATTGGCACCTGATTATCAAGATTTGCAAAGAAGTGAAAGCATAGCCAAGGGGTTTGAAGTGGTATCCCA
GCCTGTGGGGCCGAGTCAGACTCGCTGCTACTACCGGACTACCCGTGATATGTGCATAACGCCGCTGCAT
ATCACCTCTGCCACGCTGCAAAATGAAACAGATGGGCGTTCGGTGATCCGACTGCGTTTTGACTGCGGCC
AGCTGGCGGAGTGGGATAAAGTCGATTTGACGCGGTTGCCTTTGTACCTTAAAGCGGGCAGTCCGTTAAG
TTCTGCGTTACATCTGGCACTGACCCGACAGACTCAGGATATTTATGTGCGTGTGTCGGGGATGGAGCGT
CGCCGTTTTGAGGGGCATTTTTCACCCATGGGTTTCGACAGCGATGATGTCCTGTGGCCGAAAGGGGAAA
GTGCATTCAGTGGCTATCAATTGTTGCTGGAGTATTTTACTTTCCGCGAAAAATTTATGTTTGTGGCACT
TAACGGTCTGGAAACATTACATATTCCTGCCAGTACACCTTGGTTTGAATTGGAAATGGTACTGGGTGAA
CTGTGGCCGTATGAATTGCCATTTTCAGCCGAAAATATCCGGTTGCATTGTGTACCAGTGATCAATCTGT
TTAATGTTGAAGCCGATCCGATGCACATTTCTCGGATGCAAAATGAGTATTTGTTGCGCCCGATGCGGAT
TCAGGATGGTCATACCGAAATTTACTCGGTGGATGAGGTGCTCTCTTCTGGACGAGGTGAAACACAGCGT
TTTGTACCATTCAGTAGCTTCCGCCATCGGGGAGGCATCATGCGTAATGCTGCGCCAGAACGCTATTATC
ATACCCGTGTGTGTCCTAATCCTGCTGGTTTGCACGATACCTGGCTGATCCTCGGTGGTGAATCGTTTGA
AAGTGACCCGGAAATTGATGATGAAACGTTGTCGCTACGTATTACTGGTACTAACGGTCAATTACCCCGC
AGGGCATTGCGCGATACGCAACTCGAACAGACATTACAATCCACCGGCGGCAAACTGCGCGTGAAAAATC
TTTGTTCACCGACGTTGCCTTGCTATCCCCCGGCGAATGATCGTTTCCATTGGCGAGTCCTTAGCCATCT
CGGCTCTAACTTCCTCAGCATGATGGATAACCCGGAGGTGCTGCGCGGTACGTTAGGGCTTTATAACTGG
ACTAATGACGAAATGAATTGTCGTCGTTTGGATGCCATTGTTGGGGTGAAGCACAGTTTGATCCAGCGCT
TTGAAAAGGGCTATCTGCTGAGAGGGGTTGATATTGAGATTACGCTTAACAGCAACGGTTTCTCCGGCGA
GGGTGATATTTTTCTATTCGGTGAGATGCTGAACCGTTTCTTCTCTTTGTATACCGATATTCATCTGTTT
AACCAGCTGACACTGGTCCTTCAACCTTCGGAGAAATGTTTGCGATGGAAAGAAAATCACAATCAGCGTA
TTCCCGGTTAG
 Primer design