SecReT6
Protein ID: 253991292
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03819
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4435406..4437007 [-]
Producthypothetical protein
NoteTssA
UniProt IDB6VLD3
KEGG IDpay:PAU_03819
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 8.20E-21, Aligned region: 63..121
ImpA-rel_N [PF06812], Evalue: 8.20E-21, Aligned region: 151..178
ImpA-rel_N [PF06812], Evalue: 8.20E-21, Aligned region: 302..317
Protein Sequence: 533 a.a.     [Download]
>gi|253991292|ref|YP_003042648.1| hypothetical protein PAU_03819 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MLQQLITNCFAERDALAEARERAVRWENWLLPISADAPTGDDPVYNDDFQRMREELNKLSGIDTTLICQL
AEKLLTTECKDVRVATYYVWARLHQEGESGLADGLGLLAALVDRFGETLLPCRASSRKAALEWLVGTKIQ
DSLSLYPEVNRTDFEHIVSALALLEQTFATWDENARPSLVGLAGTLENRLAQSGGVDAVVPQTAAPMPLS
GGQVNSSAQGESSVLWGQVQSGRDLLERARELARYLREQPQGWLSSARLMRSVRWDTVHQLPPLDADGRT
RLVPPRTEYRALLKRLYRQQNWHDLLEQADRMFSESVNHFWLDLQWYLCQALNRLGSSYESWIEMVKHDL
RMLLERLPGLENLAYNDGTPFADEVTAGWIAQQVHDSQADWSFVHSPMQPQHDDDVLALEPEAQQLADSE
GIDAALRWLGQLPSINGARQRWLQRLLMARMAEQYGKNEMALHLLTELNTDGQFNLGEWEPALMFEVKAC
LLKLLRMKAQRSEQDKARMAQRMETLLAGLVAIDPVRAAVLCG
 
Nucleotide Sequence: 1602 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c4437007-4435406 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGTTGCAACAATTGATCACAAACTGCTTTGCCGAGCGTGATGCGCTGGCAGAAGCACGGGAAAGGGCGG
TTCGGTGGGAAAACTGGCTGTTACCCATTAGTGCTGATGCTCCCACAGGCGATGATCCGGTCTATAACGA
CGATTTTCAGCGTATGCGGGAGGAGCTGAACAAGCTCAGTGGCATTGATACCACACTTATCTGTCAATTG
GCGGAGAAACTGTTAACTACCGAATGTAAAGATGTTCGCGTGGCGACCTATTATGTGTGGGCGCGTTTAC
ATCAAGAGGGTGAAAGCGGCTTGGCCGATGGGCTGGGGTTACTGGCTGCACTAGTAGATCGTTTTGGTGA
AACCTTGTTACCTTGCCGGGCGAGCAGTCGAAAAGCTGCGCTGGAGTGGTTGGTAGGCACCAAGATTCAG
GACAGTTTGTCACTCTATCCAGAGGTAAATCGTACCGACTTTGAACATATCGTATCGGCTCTGGCGTTAC
TGGAACAGACGTTTGCTACTTGGGACGAAAATGCCCGGCCCTCCCTTGTTGGGCTGGCAGGCACTCTGGA
AAACCGATTAGCTCAGTCCGGTGGAGTGGATGCGGTGGTTCCCCAAACGGCTGCTCCGATGCCTTTATCT
GGGGGGCAGGTCAATTCATCAGCTCAGGGTGAGTCATCGGTATTATGGGGGCAGGTGCAATCCGGGCGTG
ATCTGTTGGAACGAGCACGTGAATTAGCGCGCTATCTGCGTGAACAGCCTCAAGGCTGGCTCTCTTCTGC
ACGGCTGATGCGGAGTGTCCGCTGGGATACTGTGCATCAATTACCACCACTGGATGCTGACGGGCGTACC
CGTTTGGTACCGCCACGTACAGAATATCGGGCCTTGTTAAAACGGCTCTATCGGCAACAAAACTGGCATG
ATTTATTGGAGCAAGCCGACCGAATGTTCTCGGAAAGTGTTAACCACTTTTGGCTGGATTTGCAGTGGTA
TCTCTGTCAGGCATTAAACCGATTGGGTAGCTCCTATGAAAGTTGGATAGAGATGGTGAAACATGATCTG
AGGATGCTGCTTGAACGGCTGCCGGGGCTGGAAAATCTGGCATATAACGACGGAACGCCTTTTGCCGATG
AAGTCACTGCCGGTTGGATCGCCCAACAGGTTCATGACTCTCAGGCAGACTGGTCATTTGTACATTCACC
GATGCAGCCCCAGCATGATGATGATGTTTTAGCTCTGGAACCAGAGGCGCAACAACTGGCGGACAGCGAA
GGCATAGATGCTGCATTACGCTGGCTGGGGCAGCTGCCGAGTATCAACGGAGCGCGACAGCGCTGGTTAC
AGCGCTTGCTGATGGCTCGGATGGCGGAGCAATACGGCAAAAATGAAATGGCCTTGCATTTGCTGACCGA
GCTAAACACCGATGGACAATTTAATCTTGGTGAATGGGAGCCGGCACTGATGTTTGAGGTGAAAGCATGT
CTGTTGAAGTTGCTGCGGATGAAAGCACAGCGCAGTGAACAGGATAAAGCGCGGATGGCGCAGCGCATGG
AGACTTTGTTAGCTGGACTAGTGGCGATTGATCCGGTCAGAGCTGCTGTGCTATGTGGCTGA
 Primer design