SecReT6
Protein ID: 253991295
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03822
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4441481..4441753 [-]
Producthypothetical protein
NotePAAR
UniProt IDB6VLD6
KEGG IDpay:PAU_03822
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 2.70E-18, Aligned region: 7..82
Protein Sequence: 90 a.a.     [Download]
>gi|253991295|ref|YP_003042651.1| hypothetical protein PAU_03822 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MMFAGVIRLGDKLSSGGEVISVSSSIDIEGKRVALLNDLVSCPLKGHGINRIVEANAHCISDGKPIAFDK
ARCQCGCYVISSTPKAGIGE
 
Nucleotide Sequence: 273 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c4441753-4441481 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGATGTTTGCAGGTGTTATTCGCCTGGGCGATAAGCTCAGCAGCGGCGGGGAAGTGATTTCCGTTTCTT
CCTCCATTGATATTGAAGGTAAACGCGTCGCATTATTAAATGATTTAGTCAGCTGTCCGCTAAAAGGGCA
TGGTATTAATCGTATTGTTGAGGCTAATGCTCACTGTATTTCCGATGGCAAACCGATAGCGTTTGATAAA
GCGCGTTGTCAATGTGGCTGTTATGTCATTTCCAGTACGCCTAAAGCCGGAATTGGGGAGTGA
 Primer design