SecReT6
Protein ID: 253991305
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03832
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4454078..4456756 [-]
ProductClpA/B-type chaperone
NoteTssH
UniProt IDC7BMP1
KEGG IDpay:PAU_03832
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.20E-40, Aligned region: 238..257
AAA_2 [PF07724], Evalue: 1.20E-40, Aligned region: 613..778
AAA [PF00004], Evalue: 1.40E-19, Aligned region: 26..80
AAA [PF00004], Evalue: 1.40E-19, Aligned region: 240..351
AAA [PF00004], Evalue: 1.40E-19, Aligned region: 618..736
AAA [PF00004], Evalue: 1.40E-19, Aligned region: 766..783
AAA_5 [PF07728], Evalue: 2.20E-14, Aligned region: 240..260
AAA_5 [PF07728], Evalue: 2.20E-14, Aligned region: 617..737
ClpB_D2-small [PF10431], Evalue: 1.10E-13, Aligned region: 784..858
AAA_16 [PF13191], Evalue: 3.70E-12, Aligned region: 115..198
AAA_16 [PF13191], Evalue: 3.70E-12, Aligned region: 217..261
AAA_16 [PF13191], Evalue: 3.70E-12, Aligned region: 285..318
AAA_16 [PF13191], Evalue: 3.70E-12, Aligned region: 447..479
AAA_16 [PF13191], Evalue: 3.70E-12, Aligned region: 598..653
AAA_16 [PF13191], Evalue: 3.70E-12, Aligned region: 681..712
AAA_16 [PF13191], Evalue: 3.70E-12, Aligned region: 756..865
AAA_22 [PF13401], Evalue: 7.60E-10, Aligned region: 61..95
AAA_22 [PF13401], Evalue: 7.60E-10, Aligned region: 239..334
AAA_22 [PF13401], Evalue: 7.60E-10, Aligned region: 616..711
AAA_25 [PF13481], Evalue: 5.10E-09, Aligned region: 240..316
AAA_25 [PF13481], Evalue: 5.10E-09, Aligned region: 615..646
NACHT [PF05729], Evalue: 1.50E-06, Aligned region: 240..343
NACHT [PF05729], Evalue: 1.50E-06, Aligned region: 617..638
Arch_ATPase [PF01637], Evalue: 1.60E-06, Aligned region: 218..254
Arch_ATPase [PF01637], Evalue: 1.60E-06, Aligned region: 292..389
Arch_ATPase [PF01637], Evalue: 1.60E-06, Aligned region: 611..630
Arch_ATPase [PF01637], Evalue: 1.60E-06, Aligned region: 688..703
IstB_IS21 [PF01695], Evalue: 3.30E-06, Aligned region: 234..301
IstB_IS21 [PF01695], Evalue: 3.30E-06, Aligned region: 617..635
IstB_IS21 [PF01695], Evalue: 3.30E-06, Aligned region: 846..860
AAA_19 [PF13245], Evalue: 5.50E-06, Aligned region: 237..260
AAA_19 [PF13245], Evalue: 5.50E-06, Aligned region: 615..645
AAA_17 [PF13207], Evalue: 6.80E-06, Aligned region: 240..355
AAA_17 [PF13207], Evalue: 6.80E-06, Aligned region: 616..652
Clp_N [PF02861], Evalue: 1.80E-05, Aligned region: 23..57
Clp_N [PF02861], Evalue: 1.80E-05, Aligned region: 103..124
Zeta_toxin [PF06414], Evalue: 4.80E-05, Aligned region: 235..261
Zeta_toxin [PF06414], Evalue: 4.80E-05, Aligned region: 604..657
AAA_14 [PF13173], Evalue: 7.20E-05, Aligned region: 240..343
AAA_14 [PF13173], Evalue: 7.20E-05, Aligned region: 616..707
Sigma54_activat [PF00158], Evalue: 9.80E-05, Aligned region: 222..254
Sigma54_activat [PF00158], Evalue: 9.80E-05, Aligned region: 616..734
AAA_18 [PF13238], Evalue: 0.00098, Aligned region: 240..267
AAA_18 [PF13238], Evalue: 0.00098, Aligned region: 618..638
AAA_23 [PF13476], Evalue: 0.0023, Aligned region: 240..533
AAA_23 [PF13476], Evalue: 0.0023, Aligned region: 615..641
AAA_29 [PF13555], Evalue: 0.0035, Aligned region: 234..256
AAA_29 [PF13555], Evalue: 0.0035, Aligned region: 615..630
DUF258 [PF03193], Evalue: 0.0042, Aligned region: 228..257
DUF258 [PF03193], Evalue: 0.0042, Aligned region: 617..629
RNA_helicase [PF00910], Evalue: 0.0059, Aligned region: 241..261
RNA_helicase [PF00910], Evalue: 0.0059, Aligned region: 618..638
RNA_helicase [PF00910], Evalue: 0.0059, Aligned region: 715..736
Protein Sequence: 892 a.a.     [Download]
>gi|253991305|ref|YP_003042661.1| ClpA/B-type chaperone [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MDTVSTSLLCRLNPYCAQALSAAAALCQTRAHAEITVEHWLLKLLEDGEGDITVIARRYEWDMHSLWQSL
LTTIDRLPRSINQRPRLSDSLYRLLQVAEFVASQEAGNESIRSVHLLQVLRGQPDWLRTHDGWPLMSLSV
SQLQHLRPLLDQHSAERPEVQAAARLADSGGGSAVAEIHPDKPAQNAQALSPALQGVLDKFTLDLTARAA
EGRIDPVFGRDNEIRQMIDILSRRRKNNPILVGEPGVGKTALVEGLALRIAGGQVPDSLKTVSVRSLDLG
LLQAGAGVKGEFEQRLKNVIEAVQQSPTPILLFIDEAHTLIGSGNQAGGTDAANLLKPALARGALRTIAA
TTWSEYKQYFERDAALERRFQMIKVDEPDDETACLMLRGLKARYARYHGVHIQDNAVKAAVTLSRRYLTG
RQLPDKAVDLLDTASARVRMSLDTVPEALTQRQAQLTALEMEQQAIEADSAVLPTEEDNTRLKEIAVRRE
EVARQTEQLTAQYQREKSLAQRLLDLRQHSPKTPELREGIAELAELQGNEPLLSLNVDVRTVATVVADWT
GIPLSSLLKDEQTGLLHLEQYLGDRVIGQDMALREIAQRLRAAKTGLTPEQGPLGVFLLVGPSGVGKTET
ALALADCLFGGERSLITINLSEYQEPHTVSQLKGSPPGYVGYGQGGILTEAVRQRPYSVVLLDEVEKAHR
DVLNLFYQVFDRGFMRDGEGREIDFRHTVILMTSNLGSDQLMALLAQQPDAPTATQHELLRPILRDHFQP
ALLARFQTVIYRPLSAEALRRIVDIKLGQVTRRLNTHYGLTCTVESGLCDTLVNACLLPDSGARNIDSLL
NQQILPVLSQALLERLAHHHKPVGVTLGFNEEEGIILAFTEQTAVSDSGENA
 
Nucleotide Sequence: 2679 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c4456756-4454078 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGGATACGGTATCGACTTCATTATTGTGTCGCTTAAATCCCTATTGCGCACAGGCACTAAGCGCAGCAG
CAGCACTCTGCCAGACACGAGCGCATGCTGAAATTACTGTGGAGCACTGGTTGCTAAAACTACTTGAAGA
CGGTGAGGGCGATATTACTGTGATTGCCCGGCGTTACGAGTGGGATATGCATTCGTTGTGGCAATCTTTG
TTGACCACGATTGACCGTCTGCCCCGTAGCATCAATCAACGTCCACGGTTGTCAGATAGCTTGTATCGTT
TATTACAAGTCGCTGAGTTTGTTGCTTCTCAAGAAGCAGGCAATGAATCTATTCGCTCGGTGCATTTGTT
GCAGGTGCTGCGTGGTCAGCCGGATTGGTTGCGTACTCACGATGGTTGGCCGTTGATGAGCCTGAGTGTG
AGCCAGTTACAACATTTGCGCCCGCTGCTGGATCAGCATTCAGCAGAGCGCCCGGAAGTACAGGCGGCGG
CGCGTCTGGCCGATAGCGGCGGGGGTTCTGCGGTGGCAGAAATACATCCTGATAAACCTGCTCAAAATGC
TCAAGCGTTATCACCAGCGTTACAGGGAGTATTAGACAAATTCACACTGGATTTAACGGCGCGTGCTGCC
GAGGGCCGTATTGATCCGGTGTTTGGTCGTGACAATGAAATTCGCCAAATGATCGACATTCTGTCGCGCA
GACGTAAAAACAACCCAATTTTGGTCGGTGAACCGGGGGTAGGAAAAACTGCGCTGGTGGAAGGATTGGC
CTTGCGTATTGCCGGTGGTCAGGTGCCTGATAGCCTGAAAACCGTCAGTGTGCGGTCGCTGGATCTGGGG
CTATTGCAGGCAGGCGCGGGGGTAAAAGGCGAATTTGAACAACGGCTGAAAAACGTGATTGAAGCAGTAC
AACAGTCACCCACCCCAATCTTACTGTTTATTGATGAAGCTCATACGCTGATTGGCTCTGGTAATCAGGC
AGGCGGCACCGATGCGGCTAACCTGCTCAAACCCGCACTGGCGCGGGGAGCATTACGCACGATTGCCGCC
ACTACCTGGTCGGAATACAAACAATATTTTGAGCGGGATGCGGCACTGGAACGGCGTTTTCAGATGATCA
AAGTGGACGAACCGGATGATGAAACCGCCTGCCTGATGCTGCGTGGTCTGAAAGCGCGCTATGCCCGTTA
CCATGGCGTTCATATTCAGGATAACGCCGTTAAAGCAGCGGTTACCTTATCTCGCCGTTACCTGACCGGG
CGTCAGCTCCCGGATAAAGCAGTGGATTTGCTGGATACCGCCAGCGCCCGGGTGCGGATGAGTCTGGATA
CGGTGCCGGAAGCATTGACGCAACGTCAGGCACAACTAACGGCCCTTGAAATGGAGCAACAGGCGATTGA
AGCGGATTCGGCGGTGTTGCCGACAGAAGAAGATAACACCCGTTTAAAGGAGATTGCGGTTCGGCGTGAA
GAGGTTGCACGCCAGACTGAACAACTCACAGCACAGTATCAGCGCGAAAAGAGCCTGGCTCAGCGCCTTC
TCGATTTACGTCAACATTCACCCAAAACACCTGAACTCAGGGAAGGCATAGCGGAGCTGGCAGAATTACA
GGGCAATGAGCCATTACTTTCATTGAATGTCGATGTGCGTACTGTCGCGACGGTCGTTGCCGATTGGACG
GGGATACCGTTAAGCAGTTTGCTAAAAGACGAACAAACCGGTTTGTTACATCTTGAGCAGTATTTAGGCG
ACCGGGTTATCGGTCAGGATATGGCACTGAGGGAAATCGCTCAACGTTTACGTGCGGCTAAAACCGGTTT
GACGCCGGAACAGGGGCCATTAGGCGTCTTTCTACTGGTGGGGCCAAGTGGTGTGGGGAAAACCGAAACC
GCACTGGCATTGGCCGATTGCCTGTTTGGGGGCGAACGTTCACTAATTACTATCAATTTGTCGGAATATC
AGGAACCGCATACGGTTTCTCAGCTGAAAGGTTCACCTCCGGGTTATGTGGGGTACGGACAGGGCGGCAT
TTTGACGGAAGCAGTACGTCAGCGCCCCTACAGCGTCGTGTTGTTGGATGAAGTAGAAAAAGCGCATCGT
GACGTGTTGAACCTGTTCTATCAGGTATTTGATCGCGGTTTTATGCGGGATGGTGAAGGGCGCGAGATCG
ATTTTCGTCATACCGTCATATTGATGACCTCTAATCTGGGGAGTGATCAACTGATGGCATTATTGGCACA
ACAGCCTGATGCTCCGACTGCCACCCAGCACGAATTGTTGCGTCCCATACTGCGTGATCACTTTCAGCCG
GCATTGTTGGCTCGTTTCCAGACCGTGATTTACCGCCCATTATCGGCGGAAGCGCTCAGACGGATTGTAG
ACATCAAATTGGGGCAAGTCACCCGGCGTCTAAACACCCATTATGGCCTGACCTGCACGGTGGAAAGTGG
CCTGTGCGACACGCTGGTCAATGCCTGTCTGTTGCCGGACAGTGGGGCGCGCAATATCGACAGCCTGCTC
AATCAACAAATCTTACCGGTGCTATCGCAGGCGCTGCTAGAACGTCTGGCACATCACCATAAACCTGTTG
GCGTAACGTTAGGTTTCAATGAAGAAGAGGGGATCATCCTTGCTTTCACTGAACAGACTGCCGTATCTGA
TAGCGGGGAAAATGCATGA
 Primer design