SecReT6
Protein ID: 253991307
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03834
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4457494..4459227 [-]
Producthypothetical protein
NoteTagL
UniProt IDC7BMP3, C7BMP3
KEGG IDpay:PAU_03834
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 7.50E-16, Aligned region: 441..537
Protein Sequence: 577 a.a.     [Download]
>gi|253991307|ref|YP_003042663.1| hypothetical protein PAU_03834 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MSCALRRALWLLACVLAAVLCWFFPLGKVSAALWLSVILVIAIIAWWQTGRAMREMSHQDSVCRLLAALP
AASWRQPVVLTCGENVTTLFTGEPLRITPQGCFICVPRQSEMSALVEAIITARPDWCAQISVLLTLFPEQ
QQDQSVMTAQIREFRYQVACVAQLTACRPPVLIAGYLDGDISPWFELRADRPMMTVCCEKQAAIGMNIWL
AEGDAQQRVVRLQQTVAVAAWQRWMVENVLSECQSRDLTSQPCHPIAMALMFWPQTPQANNLWTKWLIAH
TTLPRINRSIAGAVSVLPFPDAMLRLLPGYYGYSPRRRAVVWAIGLLTGFACLALTASAWNNQRLLRQIR
SDLQHYHAISMKDVGAKGLAYQQLKRDAALLEKYHRDGEPMRLGLGLYLGDHLYAPLMDVINHAVLPASP
PAQPKKDKALPRTLSLNSMSLFDVGQSRLKAGSAKVLMNALIDIKAKPGWLIVISGHTDSTGNTEKNRVL
SLARAEAVRDWLLQTSDIPLACFAVQGEGATRPVATNSTAAGRAANRRVEIRLVPNAVACQRLQPVSGSL
STTTSPVQATSHTQKQE
 
Nucleotide Sequence: 1734 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c4459227-4457494 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
TTGAGTTGTGCATTAAGGCGAGCGCTATGGCTTTTGGCTTGTGTTTTGGCTGCGGTGCTGTGCTGGTTCT
TCCCGTTGGGAAAGGTATCTGCTGCATTGTGGCTATCTGTAATTCTGGTGATAGCGATCATTGCCTGGTG
GCAAACAGGGCGTGCTATGCGTGAAATGTCCCATCAGGACAGTGTTTGTCGTTTGCTGGCGGCACTACCA
GCTGCCTCATGGCGTCAGCCTGTGGTGCTGACCTGTGGTGAGAATGTGACAACCTTGTTTACAGGAGAGC
CGCTGCGCATCACTCCACAGGGCTGTTTTATCTGCGTACCACGACAAAGTGAGATGAGTGCGCTGGTGGA
AGCCATTATTACGGCCAGACCTGACTGGTGCGCGCAGATTAGTGTGTTGTTAACACTCTTCCCTGAACAG
CAACAGGATCAGTCGGTAATGACAGCTCAGATCCGGGAGTTTCGTTATCAGGTTGCTTGTGTTGCACAAC
TAACCGCCTGCCGTCCCCCGGTGTTAATTGCTGGTTATCTTGATGGTGATATTAGCCCGTGGTTCGAATT
GCGGGCAGATCGCCCGATGATGACGGTATGTTGCGAGAAACAGGCCGCCATTGGGATGAATATCTGGTTG
GCAGAAGGAGATGCACAGCAGCGCGTTGTACGTTTACAACAGACAGTTGCCGTTGCGGCATGGCAACGTT
GGATGGTGGAAAACGTTCTGAGCGAGTGTCAGTCGCGGGATCTAACCAGCCAGCCTTGTCACCCCATCGC
AATGGCACTGATGTTTTGGCCCCAAACTCCGCAGGCAAACAATCTTTGGACAAAATGGCTGATTGCCCAT
ACAACTTTACCCCGCATCAACCGCAGCATCGCTGGTGCTGTGAGTGTACTGCCATTTCCTGATGCAATGT
TGCGCTTGTTGCCAGGTTATTACGGCTATTCACCGCGCCGGCGTGCAGTAGTTTGGGCGATTGGCTTGCT
GACGGGATTTGCTTGTCTGGCATTAACAGCCAGTGCTTGGAATAACCAGCGTTTGCTACGCCAGATACGT
AGTGATTTACAACATTACCATGCTATTAGCATGAAAGACGTTGGTGCTAAAGGGCTGGCTTATCAGCAAC
TCAAACGCGACGCAGCATTGTTGGAAAAATATCATCGGGATGGTGAACCGATGCGTTTGGGGCTGGGGCT
TTATTTGGGTGATCACCTTTATGCGCCGTTGATGGATGTTATCAACCATGCGGTATTACCGGCATCACCG
CCTGCGCAGCCGAAGAAAGACAAAGCGCTGCCGCGGACGTTGAGTCTTAACAGCATGTCATTATTCGATG
TTGGACAATCCCGCCTTAAGGCCGGATCTGCCAAAGTTCTGATGAACGCATTGATAGATATCAAGGCTAA
ACCCGGCTGGCTGATTGTGATTAGCGGTCATACCGATTCCACTGGCAATACTGAGAAAAACCGCGTGTTA
TCACTGGCGCGAGCAGAAGCGGTACGCGACTGGTTATTACAAACCAGTGATATTCCGCTCGCTTGCTTTG
CCGTACAGGGCGAAGGTGCAACGCGGCCAGTCGCCACCAATTCAACGGCTGCGGGGCGAGCTGCCAACCG
CAGAGTTGAAATCCGTCTGGTACCTAACGCAGTCGCCTGCCAGCGACTGCAACCAGTGTCAGGCTCTTTA
TCAACAACAACGTCGCCGGTGCAGGCGACATCACACACTCAAAAACAGGAGTAA
 Primer design