SecReT6
Protein ID: 253991308
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03835
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4459238..4459888 [-]
Producthypothetical protein
NoteTssL
UniProt IDC7BMP4
KEGG IDpay:PAU_03835
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.20E-41, Aligned region: 17..207
Protein Sequence: 216 a.a.     [Download]
>gi|253991308|ref|YP_003042664.1| hypothetical protein PAU_03835 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MNKMISIDDLMLGIGILVIALRNGDKSVHGEALYQKGVELIESAQQQLSESDVSEDDMTHMIYALCALLD
ETVLSRPGRDNGHETWSKTLLQTRFFNTHHAGERLFERIRQVLNQSQPSLMVLTCFQRVLALGFQGGDNE
QIAQERQSLLDVLTQRAGEMVVQPYQTIQTNACRRQGKFWRSRSLWFWGCQAMGVIALMWLGLHFYLQQY
LSAGQG
 
Nucleotide Sequence: 651 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c4459888-4459238 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGAACAAAATGATCTCAATCGACGACCTGATGCTTGGCATTGGGATATTGGTGATTGCACTGAGAAACG
GTGATAAGTCGGTGCATGGTGAGGCGTTATATCAAAAAGGGGTTGAGTTGATAGAAAGTGCACAGCAGCA
ATTAAGTGAAAGTGATGTTAGTGAAGATGACATGACTCACATGATCTATGCCTTGTGCGCATTGCTGGAT
GAAACCGTACTCAGTCGTCCTGGCCGGGATAATGGTCATGAAACTTGGTCGAAAACGCTGTTGCAGACGC
GATTTTTTAATACTCATCATGCCGGTGAGCGGTTGTTTGAACGTATCCGTCAGGTATTGAATCAATCGCA
ACCTTCCTTGATGGTACTGACTTGTTTCCAGCGCGTATTAGCACTGGGTTTTCAGGGGGGTGATAACGAG
CAGATTGCACAGGAGCGCCAGTCATTACTGGATGTATTGACTCAGCGTGCGGGGGAAATGGTGGTGCAAC
CATATCAAACGATACAGACAAATGCATGTCGTCGTCAGGGAAAATTCTGGCGTTCACGCTCTCTGTGGTT
CTGGGGGTGTCAGGCAATGGGCGTGATAGCTTTGATGTGGTTGGGCTTGCATTTCTATCTTCAGCAATAT
TTGTCTGCTGGGCAAGGCTAA
 Primer design