SecReT6
Protein ID: 253991309
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03836
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4459885..4461246 [-]
Producthypothetical protein
NoteTssK
UniProt IDC7BMP5
KEGG IDpay:PAU_03836
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.40E-137, Aligned region: 19..450
Protein Sequence: 453 a.a.     [Download]
>gi|253991309|ref|YP_003042665.1| hypothetical protein PAU_03836 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MMKILRPLWIEDAFLAPQQFQQQASWEALTNDCIAHLGLIHPWGVLDIQFDQDALRLNRLKVQHLRARLQ
DGTLIDTDHADNLPIACDLRQVVPEDLRTVEVLLALPLEHANGGNCRQSSEEVVPGQPPLRYQQEWIEIQ
DRFGSASESIAVERYAFSLRFKHDENGAYLTCPLARLVRDGHAGWTLDNSFIPPLLSFAAHPPLLEQLEL
LLIQLRAKRARLMGMRRESNQRMADFAVADVSLFWLLNALNSYEPVLNDFKAGPALHPEIIYREMVKLAG
ALLTFSLDHDLDAIPGYQHDQLSDVFPPLMQLISTLLEARLPSRVIAIELEVVRENQWKASFHDRRLCEE
ADFYLSVRSSIPAHQLQIQFPHLCKVGAPDDIDRLINRSLSGVPLRPLSHVPAAIPLRLENQYFAFDLNN
PLAKVMLEAGSCAFYVPGTLSGVQLELFAVLRS
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c4461246-4459885 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGATGAAAATTTTACGTCCTCTTTGGATTGAAGATGCCTTTTTGGCACCTCAACAATTTCAGCAACAGG
CAAGTTGGGAAGCGCTGACTAACGATTGCATTGCTCATCTGGGATTGATCCATCCCTGGGGAGTGCTGGA
CATTCAGTTTGATCAGGATGCACTGCGTTTAAACCGACTGAAAGTTCAGCACCTTAGGGCCCGTTTACAG
GATGGGACGCTGATTGACACCGATCATGCCGACAATCTGCCTATTGCCTGCGATTTGCGGCAGGTTGTAC
CGGAGGATCTGCGCACTGTTGAGGTATTACTGGCATTACCGTTGGAACACGCTAATGGCGGGAACTGCCG
TCAGAGCAGTGAGGAGGTCGTGCCGGGACAACCGCCGCTGCGTTATCAGCAAGAGTGGATTGAAATACAG
GACAGATTCGGCAGTGCGAGTGAGTCAATTGCGGTTGAACGCTACGCATTTTCTCTGCGTTTTAAGCATG
ACGAAAATGGAGCTTATTTGACCTGTCCGCTGGCACGTTTAGTACGTGACGGACATGCAGGTTGGACGCT
TGATAATAGCTTTATTCCGCCGCTGCTCTCCTTCGCGGCCCATCCTCCACTGCTGGAACAGCTCGAACTG
TTGCTAATTCAGCTACGTGCTAAACGCGCTCGTCTGATGGGGATGCGCCGTGAAAGTAATCAACGGATGG
CAGACTTCGCTGTGGCTGATGTTTCGCTGTTCTGGTTACTGAATGCACTCAATAGCTATGAGCCGGTGCT
GAATGATTTTAAGGCGGGACCCGCATTGCACCCGGAAATCATCTACCGTGAAATGGTGAAATTGGCTGGG
GCGTTGCTGACGTTCTCATTGGATCACGATCTCGACGCGATCCCTGGTTATCAACACGATCAGTTAAGTG
ATGTTTTTCCGCCTCTAATGCAGCTGATTAGCACTCTGCTTGAAGCCAGATTGCCATCAAGGGTGATTGC
GATTGAATTGGAAGTTGTGCGTGAGAATCAGTGGAAAGCATCGTTTCATGATAGACGCTTGTGCGAAGAG
GCTGATTTCTATCTCTCTGTGCGATCGTCGATACCGGCACATCAGCTGCAAATCCAGTTTCCGCATTTGT
GTAAAGTAGGGGCACCCGATGATATTGATCGGTTGATTAACCGGTCATTAAGCGGCGTTCCTTTACGTCC
ACTAAGTCATGTGCCGGCAGCGATCCCGCTGCGGTTGGAAAACCAGTATTTTGCTTTCGATCTGAATAAT
CCGTTGGCTAAAGTCATGCTGGAAGCGGGAAGCTGTGCCTTCTATGTGCCCGGTACGTTATCGGGCGTTC
AGTTAGAGCTATTTGCGGTATTACGTTCATGA
 Primer design