SecReT6
Protein ID: 253991310
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03837
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4461263..4462789 [-]
Producthypothetical protein
NoteTssC
UniProt IDC7BMP6
KEGG IDpay:PAU_03837
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.30E-176, Aligned region: 85..504
Protein Sequence: 508 a.a.     [Download]
>gi|253991310|ref|YP_003042666.1| hypothetical protein PAU_03837 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MTVQEQAASVTTAHSEGSVYQALFKKINLQPVEQLNGFDLFQNNDALADVTTDERVTAAVSVFLTLLKES
AQKVERLDKTLLDYHIGVLDHQISRQLDVVIHQPEFQQVESAWRGLKFLVDRTDFRQNVRIEVLDVTKED
LQQDFDDAPEIAQSGFYRHTYIQEYDTPGGEPIGSVIANYEFGAGSQDIALLRNIAKVAAAAHMPFIASA
SPAFFGKETMEEVASIKDIGNYFDRAEYIKWKSFRDSDDARYIGLTLPRVLGRLPYGPDTVPVRTFNYLE
QVKGPDHSKYLWTNAAFAFAANMVKSFVKNGWCVQIRGPQAGGAVTDLPIHFYDLGIGNQAKIPSEVMIP
ETREFEFANLGFIPLSFYKNRDYACFFSANSTQKPAVYDTGEATANSRINARLPYIFLLSRIAHYLKLIQ
RENIGTTKDRRLLEIELNNWINTLVTEMTDPSDDLQASHPLREARVIVEDIDDNPGFFRVRLYAVPHFQV
EGLDVNLSLVSQMPKAKE
 
Nucleotide Sequence: 1527 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c4462789-4461263 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGACGGTACAAGAGCAAGCTGCTTCTGTGACGACGGCCCACAGTGAAGGCAGTGTTTATCAAGCATTAT
TTAAGAAAATTAACTTACAGCCAGTCGAACAGTTAAATGGTTTTGATCTTTTTCAGAACAATGATGCGTT
GGCTGATGTGACGACGGATGAGAGAGTCACCGCGGCGGTCAGTGTTTTTCTCACGCTGCTGAAAGAATCG
GCACAAAAAGTTGAGCGATTGGATAAAACCTTGCTGGATTATCATATTGGTGTGTTGGATCACCAAATCA
GCCGTCAATTGGATGTCGTGATACATCAACCGGAATTCCAGCAAGTAGAATCAGCCTGGCGGGGCCTGAA
GTTTCTGGTTGACCGGACGGATTTCCGTCAGAACGTCAGAATTGAAGTGCTGGATGTCACCAAAGAGGAT
TTGCAACAAGATTTTGATGATGCGCCGGAAATTGCTCAAAGCGGTTTCTATCGCCATACCTACATTCAGG
AATACGATACACCGGGCGGTGAACCTATCGGATCGGTGATTGCCAACTATGAATTTGGTGCTGGATCGCA
GGATATTGCCCTGTTGCGCAATATCGCTAAAGTGGCAGCAGCGGCACATATGCCCTTTATTGCTTCTGCT
AGCCCGGCCTTTTTCGGTAAGGAAACCATGGAAGAGGTTGCGTCCATTAAAGACATTGGTAACTACTTTG
ACCGCGCCGAATACATCAAATGGAAATCCTTCCGCGACAGCGATGATGCCCGTTATATCGGCCTGACATT
GCCGCGGGTGTTAGGACGTTTACCGTATGGCCCGGATACCGTGCCGGTGCGAACGTTTAATTATCTTGAG
CAGGTTAAAGGTCCGGATCACAGTAAATACTTGTGGACCAATGCGGCTTTCGCGTTTGCGGCCAACATGG
TGAAAAGCTTTGTGAAAAATGGCTGGTGTGTACAGATCCGTGGGCCACAGGCGGGTGGGGCGGTGACTGA
TTTGCCGATCCATTTCTACGATTTGGGAATTGGTAATCAGGCAAAAATTCCCTCAGAAGTGATGATCCCG
GAAACCCGCGAGTTTGAATTTGCCAATTTGGGATTTATTCCGCTCTCTTTCTATAAAAACCGCGATTACG
CCTGTTTCTTCTCGGCTAACTCGACGCAGAAACCAGCGGTATATGATACGGGTGAAGCGACAGCTAACAG
CCGCATCAATGCGCGTCTGCCGTATATCTTCCTGCTGTCTCGCATTGCCCATTACCTGAAATTGATCCAA
CGGGAAAACATCGGCACCACCAAGGATCGTCGTCTGCTTGAAATTGAGCTAAACAACTGGATCAACACGC
TGGTGACCGAGATGACCGATCCGTCTGACGATCTACAAGCTTCGCATCCACTGCGTGAAGCGCGAGTGAT
CGTTGAGGATATTGACGACAATCCGGGGTTCTTCCGGGTCAGGCTGTATGCGGTACCTCATTTCCAAGTA
GAAGGGCTTGACGTCAATCTGTCGCTGGTTTCTCAGATGCCGAAAGCGAAAGAGTAA
 Primer design