SecReT6
Protein ID: 253991311
SecReT6 ID358
T6SS typei3
Gene symbol-
Locus tagPAU_03838
StrainPhotorhabdus asymbiotica subsp. asymbiotica ATCC 43949
Repliconchromosome [GenBank: NC_012962] [Browse all T6SS(s) in this replicon]
Location [Strand]4462838..4463335 [-]
Producthypothetical protein
NoteTssB
UniProt IDC7BMP7
KEGG IDpay:PAU_03838
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.70E-56, Aligned region: 6..158
Protein Sequence: 165 a.a.     [Download]
>gi|253991311|ref|YP_003042667.1| hypothetical protein PAU_03838 [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
MAASFQNEVPKARINIKLDLHTGGAQKKVELPLKLLVMGDYSNGREQRPLSEREKVDINKNNFDSVLAEF
SPAVNLTVENTLVGDGSETNIDLTFRQIKDFEPEQVARQIPQLRALLSMRNLLRDLKSNLLDNATFRREL
EHILRDDQLSDELRAELAALAPKEG
 
Nucleotide Sequence: 498 bp     [Download]
>gi|253987483|ref|NC_012962.1|:c4463335-4462838 Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949 chromosome, complete genome
ATGGCTGCGAGTTTTCAAAATGAAGTTCCTAAAGCGCGTATTAATATTAAATTGGATTTACATACGGGTG
GGGCGCAGAAAAAAGTTGAGTTGCCGCTGAAATTATTGGTTATGGGCGATTACAGCAACGGACGGGAACA
GCGTCCGCTCTCGGAAAGAGAAAAGGTTGATATTAATAAAAACAATTTTGACAGTGTATTGGCTGAATTT
AGCCCCGCCGTTAACCTGACAGTCGAAAATACCTTGGTTGGAGATGGGAGTGAAACGAATATTGATCTCA
CTTTCCGGCAAATAAAAGACTTTGAGCCTGAGCAAGTGGCCCGACAAATTCCACAACTCCGGGCGTTGCT
TTCTATGCGTAATCTGTTGCGCGATCTGAAATCTAATCTGCTTGACAATGCCACGTTTCGCCGGGAGCTG
GAACACATTCTCCGGGATGACCAGCTGAGCGATGAACTGCGGGCGGAACTGGCGGCGCTGGCACCGAAAG
AAGGTTGA
 Primer design