SecReT6
Protein ID: 254785760
SecReT6 ID359
T6SS typei5
Gene symbolicmF
Locus tagTERTU_1664
StrainTeredinibacter turnerae T7901
Repliconchromosome [GenBank: NC_012997] [Browse all T6SS(s) in this replicon]
Location [Strand]1717165..1720698 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDC5BU11
KEGG IDttu:TERTU_1664
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 5.00E-95, Aligned region: 198..460
ImcF-related_N [PF14331], Evalue: 5.00E-95, Aligned region: 543..596
ImcF-related_N [PF14331], Evalue: 5.00E-95, Aligned region: 843..867
IcmF-related [PF06761], Evalue: 2.80E-56, Aligned region: 508..806
DUF1215 [PF06744], Evalue: 2.90E-32, Aligned region: 909..1028
AAA_16 [PF13191], Evalue: 0.0055, Aligned region: 132..199
AAA_16 [PF13191], Evalue: 0.0055, Aligned region: 537..635
AAA_16 [PF13191], Evalue: 0.0055, Aligned region: 917..952
Protein Sequence: 1177 a.a.     [Download]
>gi|254785760|ref|YP_003073189.1| type VI secretion protein IcmF [Teredinibacter turnerae T7901]
MKKLKAFFTNPHVIIGLAFIFVGLLIWFAGPHTKFGDDNTAPLASTTSRLICLIVLLAIWGANNLRSQWL
TRKNNDSLVDDITKNQKEAPKGVSPQVTEEVQQINARFTEALTTLKKLKFGGGGKKALYELPWYIIVGPP
GSGKTTALVNSGLDFPLAEKFGKGALQGVGGTRNCDWWFTNDAVLIDTAGRYTTQDSHRVADGGAWEGFL
SLLKKNRRRRPINGAVVAISLQDLLMQSEDERAQNAKVIRARLDELMEKLQIRFPIYLMFTKTDLVSGFS
EFFEDLNRDDRDQVWGLSLPNAPKANQSPDFNFLEEQMGSLISRLYDRVLWRMHQERDPKRRGAIYGFPQ
QMENLQAIVTGFVQQAFAENRYQFQPYLRGVYFSSGTQDGTPIDRLMSSVSANFGFPRDVAHLATQQGKS
FFLSRLFLDVIFPESELVGSNVRYERFIRWAQRATYAALALVTLGTGLIWSGALTRQTMSMGEVQQHVDE
YTQEREKVKDWNKDLRVVLPPLNALFQASRVYDQEAHPWLSGMGLYDNRVDAQADAAYKEQLKALLLPRL
IDALERSLKQGYEGGDLYNTFRIYMMFGKVDRLEPTLVEQWFNDEWEVALEGEATRRQELKLHLENLLAL
SLAPLELNPRIVRDTRTTLLRVPVAQRIYQRVKNNAEYNYPVDMLNEFGESVRENFQLEGKDLSMSALYT
IDTYERLDLSEGASLIGDVENERWLLADDKDERVDFVGEDLEEISEDVKELYLADYAANWSRLLRNLEVK
NYTSINQLNDGLMVFSDAIYSPLKAILQVGKEHTQLTMPLVQDVTAQEDSNSKSRLSRAKRLAAANIETT
RVDKQFSELHAMLRESRSGLAPVDGVMQKLQQLQEFVAEISMSPDPGKKSFDVAKARFQGGGGNPITSLR
SYAQTQPEPIERWLTSLADETWRLVLANARQYVNVEWRAQVYNPYRQGLSGRYPLAGNSRDEMAMYDFSA
FFKPSGTLDVFYQQYISPFVDSRNNLANRVVDKYSIGFNRTTMNQIQKGLTIKNILFRANPEAPSIQLEL
RPYKMDERHARFTLELGDERLVYNHGPKFWKDVSWSGTGDNNRIRVIFQDLNDRTVDQSYGGPWSWFRLL
DASSVTQTNQANVYNVAFKVVAANGEEHSILYQAKTKSIHNSMDRSWLTSLSLAESL
 
Nucleotide Sequence: 3534 bp     [Download]
>gi|254784273|ref|NC_012997.1|:1717165-1720698 Teredinibacter turnerae T7901 chromosome, complete genome
ATGAAAAAACTTAAAGCATTTTTCACCAATCCGCACGTTATTATCGGGTTGGCGTTTATTTTTGTGGGAT
TACTTATTTGGTTTGCCGGGCCGCACACCAAATTCGGTGACGACAATACTGCGCCACTTGCCAGTACAAC
GTCGCGTCTGATCTGTCTGATAGTGTTATTGGCGATTTGGGGAGCCAACAACTTGCGCTCCCAGTGGCTG
ACGCGAAAAAATAACGACAGTCTTGTTGACGATATTACAAAAAATCAAAAAGAAGCCCCCAAGGGGGTAT
CCCCTCAAGTCACGGAAGAAGTTCAGCAAATCAATGCCCGTTTCACCGAAGCGTTAACCACACTAAAAAA
GCTGAAATTTGGCGGCGGTGGCAAAAAAGCGCTGTACGAATTGCCTTGGTACATCATCGTGGGTCCGCCA
GGTTCGGGTAAAACCACCGCCCTGGTAAACTCCGGGCTGGATTTTCCGTTAGCCGAAAAGTTTGGCAAGG
GCGCGTTGCAGGGGGTAGGCGGTACCCGAAATTGCGACTGGTGGTTCACCAATGATGCGGTGCTTATTGA
TACCGCAGGACGATACACAACGCAGGACAGTCATCGCGTTGCAGACGGAGGCGCCTGGGAAGGCTTTCTA
AGTCTGCTGAAGAAAAATCGCCGTCGCCGCCCTATTAATGGTGCCGTCGTTGCGATTAGCCTTCAGGATC
TGCTGATGCAGAGTGAGGACGAGCGCGCACAAAATGCAAAAGTCATTCGTGCACGTCTTGATGAACTGAT
GGAAAAGCTTCAAATCCGATTTCCTATTTATCTGATGTTCACTAAAACCGATCTGGTATCTGGTTTTTCA
GAGTTTTTCGAAGACCTTAATCGGGACGATAGAGATCAAGTGTGGGGGTTATCGCTTCCCAACGCCCCAA
AGGCGAACCAAAGCCCGGATTTTAATTTTTTAGAGGAACAGATGGGGAGCCTGATTAGTCGGCTCTATGA
TCGCGTGCTCTGGCGTATGCATCAGGAGCGAGACCCAAAACGCCGGGGGGCTATTTATGGGTTCCCGCAA
CAAATGGAGAATCTGCAGGCAATTGTTACAGGTTTTGTACAGCAGGCGTTCGCAGAAAATCGTTATCAGT
TTCAGCCGTATTTGCGCGGCGTTTATTTTTCCAGCGGTACCCAAGACGGAACACCCATAGATCGATTAAT
GTCATCCGTTTCCGCTAACTTCGGCTTCCCTCGTGACGTGGCTCATTTGGCAACACAGCAGGGTAAAAGC
TTTTTCCTTTCCCGCTTGTTTCTGGATGTGATTTTTCCGGAATCGGAATTGGTTGGCTCCAATGTTCGCT
ACGAGCGGTTCATTCGCTGGGCTCAGCGCGCAACCTACGCGGCCTTGGCTCTCGTTACCCTCGGTACAGG
GTTGATTTGGAGCGGTGCACTCACTCGGCAAACAATGTCAATGGGGGAAGTTCAGCAGCATGTGGACGAA
TACACCCAAGAGCGCGAAAAAGTCAAAGATTGGAACAAGGATTTACGTGTTGTACTGCCCCCGCTGAATG
CGCTATTTCAGGCAAGCCGCGTTTACGATCAAGAGGCGCATCCCTGGTTGAGCGGAATGGGTTTGTATGA
TAATCGGGTAGATGCGCAAGCGGATGCCGCCTATAAAGAACAGCTGAAGGCGTTGCTGCTGCCTCGTTTA
ATTGATGCACTTGAGCGGTCGCTTAAGCAGGGCTACGAAGGCGGCGATCTTTATAATACATTTCGTATTT
ACATGATGTTTGGCAAGGTAGATCGTTTAGAACCCACTTTGGTCGAGCAGTGGTTTAATGACGAGTGGGA
AGTTGCCTTGGAAGGGGAAGCAACTCGCCGACAGGAATTGAAACTGCATTTGGAAAACCTGTTGGCACTG
TCTCTCGCACCTTTAGAATTGAACCCTCGGATAGTACGGGATACGCGGACGACGTTGCTGCGTGTTCCTG
TTGCGCAACGGATATATCAACGGGTTAAAAATAACGCCGAATACAATTATCCCGTGGATATGCTCAATGA
GTTTGGTGAGTCAGTTCGTGAAAATTTCCAGTTGGAGGGCAAAGATCTCTCTATGTCTGCCCTCTATACC
ATAGATACCTACGAACGTTTGGATCTATCTGAGGGCGCGTCGTTAATTGGCGATGTGGAAAACGAACGCT
GGTTGCTGGCAGACGATAAGGACGAGAGGGTGGATTTTGTTGGCGAAGATCTTGAAGAAATCAGTGAAGA
TGTTAAAGAGCTTTATCTAGCAGATTACGCAGCAAACTGGTCGCGTTTACTGCGAAACTTAGAGGTGAAA
AACTACACCAGTATCAATCAGCTAAACGACGGGCTCATGGTTTTTTCTGACGCTATTTATTCGCCGTTAA
AAGCCATTTTGCAGGTCGGTAAAGAGCATACGCAATTGACTATGCCGCTGGTCCAGGACGTAACTGCGCA
AGAAGATAGTAATAGTAAAAGTCGACTGTCTCGCGCTAAGCGGCTCGCAGCTGCAAATATCGAAACTACC
AGGGTCGACAAACAGTTTAGCGAACTCCACGCGATGTTACGTGAGTCGCGCAGCGGTTTGGCGCCGGTGG
ATGGTGTGATGCAAAAGCTGCAGCAATTGCAGGAATTTGTCGCTGAGATTTCTATGTCTCCCGATCCCGG
TAAAAAGTCGTTCGACGTTGCGAAAGCACGATTCCAAGGCGGCGGCGGAAATCCGATTACCTCGCTGCGC
AGCTACGCGCAAACACAACCTGAGCCAATAGAGCGCTGGCTAACAAGCCTGGCGGATGAAACATGGCGAC
TGGTGTTAGCCAACGCGCGTCAGTACGTGAACGTGGAATGGCGGGCGCAGGTTTACAACCCTTATCGGCA
AGGTTTGTCCGGGCGTTACCCGTTGGCAGGTAACAGTCGCGATGAAATGGCAATGTACGATTTCTCCGCT
TTTTTTAAACCCTCTGGAACATTGGATGTGTTTTATCAACAGTATATTTCGCCGTTTGTCGATTCGCGAA
ATAATCTGGCAAATCGCGTTGTTGATAAATACAGTATTGGGTTTAATCGCACCACCATGAACCAAATACA
AAAAGGTTTAACGATTAAAAACATTTTGTTCAGGGCGAACCCGGAGGCTCCCAGTATCCAGTTGGAATTG
CGGCCCTACAAAATGGACGAGCGTCACGCGCGTTTTACCCTTGAACTTGGAGATGAACGGTTGGTATACA
ATCACGGCCCCAAATTCTGGAAAGATGTTTCCTGGTCGGGTACCGGCGATAACAACCGAATTCGGGTTAT
TTTCCAGGACTTGAACGATAGAACGGTTGACCAGTCATACGGTGGCCCCTGGTCCTGGTTCCGTCTGCTA
GATGCATCCAGCGTCACTCAGACAAACCAGGCCAACGTTTATAACGTAGCGTTTAAAGTGGTTGCTGCCA
ACGGGGAAGAGCACAGCATTTTATATCAGGCGAAAACCAAAAGTATTCACAACTCGATGGATCGCTCCTG
GTTGACATCGCTCAGTTTGGCGGAGTCACTTTAA
 Primer design