SecReT6
Protein ID: 254791348
SecReT6 ID360
T6SS typei1
Gene symbol-
Locus tagECSP_0221
StrainEscherichia coli O157:H7 str. TW14359
Repliconchromosome [GenBank: NC_013008] [Browse all T6SS(s) in this replicon]
Location [Strand]243517..243996 [-]
Producthypothetical protein
NoteTssD
UniProt IDC6UWW8
KEGG IDetw:ECSP_0221
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 7.70E-31, Aligned region: 6..143
Protein Sequence: 159 a.a.     [Download]
>gi|254791348|ref|YP_003076185.1| hypothetical protein ECSP_0221 [Escherichia coli O157:H7 str. TW14359]
MANLIYLTLNGDNQGLISSGCSSQPSIGNKAQTAHIDQIMIYEFMHGLNRDQNVNHHHLTIKKPIDKASP
LLGKAICDNELLTCDFSFYRTNKFGINELFYKIKLTGAKISDIHVSISHIVVDNSVQPEESVSFSYESII
WEHCSAGTSAYSLWEDRLF
 
Nucleotide Sequence: 480 bp     [Download]
>gi|254791136|ref|NC_013008.1|:c243996-243517 Escherichia coli O157:H7 str. TW14359 chromosome, complete genome
ATGGCGAATTTAATTTATTTAACACTAAATGGTGATAATCAAGGGCTCATTTCAAGTGGTTGTTCATCAC
AACCATCCATTGGAAATAAAGCTCAAACAGCACACATTGATCAAATTATGATTTATGAATTCATGCATGG
ATTAAATCGAGATCAAAACGTCAACCATCATCATTTGACAATAAAAAAACCTATAGATAAAGCATCACCC
TTATTAGGCAAAGCAATTTGCGACAATGAATTATTGACATGTGATTTTTCCTTTTATCGTACAAATAAAT
TTGGAATTAATGAACTGTTCTATAAAATCAAATTAACTGGAGCAAAGATAAGCGACATTCATGTCTCTAT
ATCACATATTGTTGTTGATAACAGCGTTCAACCCGAAGAGTCAGTTTCTTTCAGTTATGAGTCAATTATA
TGGGAGCATTGTTCCGCTGGCACTAGTGCATACAGTTTATGGGAAGATCGTCTTTTTTAA
 Primer design