SecReT6
Protein ID: 254791349
SecReT6 ID360
T6SS typei1
Gene symbol-
Locus tagECSP_0222
StrainEscherichia coli O157:H7 str. TW14359
Repliconchromosome [GenBank: NC_013008] [Browse all T6SS(s) in this replicon]
Location [Strand]243962..245461 [-]
Producthypothetical protein
NoteTssA
UniProt IDC6UWW9
KEGG IDetw:ECSP_0222
PDB IDNA
Domain hit(s) vs Pfam DUF3702 [PF12486], Evalue: 2.20E-44, Aligned region: 322..466
ImpA-rel_N [PF06812], Evalue: 6.90E-21, Aligned region: 71..130
Protein Sequence: 499 a.a.     [Download]
>gi|254791349|ref|YP_003076186.1| hypothetical protein ECSP_0222 [Escherichia coli O157:H7 str. TW14359]
MCIPTRKITRSAVGCSASLVCQTHCTEEAGMNSNVLTQTIVTGSDPRGLPEFSAIREEINKASHPSQPEL
NWKLVESLALAIFKANGVDLHTATYYTLARTRTQGLAGFCEGAELLAAMVSHDWDKFWPQGGPARTEMLD
WFNSRTGNILRQQISFAESDLPLIYRTERALQLICDKLQQVELKRVPRVENLLYFMQNTRKRLEPQLKSN
TENAAQTTVRTLIYAPETQASSTPEAVVPPLPGLPEMKVEVRSLTENPPQASVIKQGSTVRGFIAGIACS
VAVASALWWWQVYPVQQQLLQVNDTAQGAATVWMASPELENYERRLQQLLDTSPVQPLETGMQMMRVADS
RWPESLQQQQASTQWNEALKTRAQSSPQLRGWLQTRQDLHAFADLVMQREKEGLTLSYIKNVIWQAERGL
GQETPVESLLTQYQDARAQKQNTDALEKQINERLEGVLSRWLLLKNNTIPTIKKALNFNNIHEYKGVLNG
EFNLFNTKW
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|254791136|ref|NC_013008.1|:c245461-243962 Escherichia coli O157:H7 str. TW14359 chromosome, complete genome
GTGTGCATACCGACACGGAAGATAACCCGTTCAGCGGTGGGTTGTTCAGCCAGTTTGGTCTGTCAGACAC
ACTGTACTGAGGAGGCAGGGATGAATAGTAACGTACTGACACAAACTATCGTTACCGGCAGTGACCCGCG
CGGGCTGCCGGAATTCAGCGCCATCCGCGAGGAAATAAACAAAGCCAGCCACCCGTCACAGCCTGAGCTG
AACTGGAAACTGGTGGAGTCGCTGGCGCTGGCGATTTTTAAAGCCAACGGTGTGGATTTACACACCGCCA
CCTACTATACGCTTGCCCGGACACGGACACAGGGACTGGCGGGATTCTGCGAAGGTGCGGAACTGCTGGC
GGCAATGGTAAGCCACGACTGGGATAAGTTCTGGCCGCAGGGCGGCCCGGCGCGTACTGAAATGCTGGAC
TGGTTTAACTCCCGAACCGGCAATATTCTGCGTCAGCAAATCTCCTTTGCGGAATCCGACCTACCACTGA
TCTACCGCACAGAGCGGGCATTGCAGCTTATCTGCGATAAGCTCCAGCAGGTGGAACTGAAGCGCGTTCC
GCGCGTGGAGAATCTGCTCTATTTTATGCAGAACACGCGTAAACGGCTTGAACCCCAGCTGAAGAGTAAC
ACTGAGAACGCCGCACAGACCACGGTCAGAACGCTGATTTATGCCCCGGAAACACAGGCATCTTCCACAC
CAGAAGCGGTAGTGCCTCCCCTGCCCGGCCTGCCTGAGATGAAAGTGGAAGTGCGCAGTCTGACAGAGAA
TCCCCCACAGGCCAGTGTGATAAAGCAAGGCAGTACGGTAAGAGGGTTTATCGCAGGGATCGCCTGTTCA
GTGGCTGTCGCCTCAGCATTGTGGTGGTGGCAGGTCTATCCGGTGCAGCAGCAACTGTTACAGGTTAACG
ACACCGCTCAGGGCGCAGCAACGGTGTGGATGGCCTCACCTGAACTCGAAAACTATGAGCGCAGGCTGCA
ACAACTTCTTGATACCTCCCCGGTACAGCCGCTGGAAACCGGGATGCAGATGATGCGTGTTGCCGACAGT
CGCTGGCCGGAAAGCCTGCAACAGCAACAGGCCTCGACACAATGGAATGAGGCACTCAAAACCCGCGCAC
AGAGTAGCCCGCAGTTGCGTGGCTGGTTGCAGACCCGCCAGGACTTACATGCTTTTGCAGATCTAGTGAT
GCAGCGCGAGAAAGAGGGACTAACCCTTTCCTATATCAAAAATGTCATCTGGCAGGCGGAGCGGGGACTG
GGGCAGGAAACACCCGTTGAGTCTCTGTTGACGCAGTACCAGGATGCCCGTGCGCAGAAGCAGAATACAG
ATGCGCTGGAAAAACAAATTAATGAGCGACTCGAAGGCGTGTTAAGCCGCTGGCTGCTGCTGAAGAATAA
TACGATACCGACGATAAAAAAAGCATTGAATTTCAATAACATTCATGAATACAAAGGAGTTTTAAATGGC
GAATTTAATTTATTTAACACTAAATGGTGA
 Primer design

Protein ID: 254791351
SecReT6 ID360
T6SS typei1
Gene symbol-
Locus tagECSP_0224
StrainEscherichia coli O157:H7 str. TW14359
Repliconchromosome [GenBank: NC_013008] [Browse all T6SS(s) in this replicon]
Location [Strand]248953..250365 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDC6UWX1
KEGG IDetw:ECSP_0224
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.80E-08, Aligned region: 54..111
ImpA-rel_N [PF06812], Evalue: 3.80E-08, Aligned region: 152..183
Protein Sequence: 470 a.a.     [Download]
>gi|254791351|ref|YP_003076188.1| ImpA domain-containing protein [Escherichia coli O157:H7 str. TW14359]
MAMDLRDPNVWISHLLENLPEEKLASALKDDNPDWEYIDGEIVKLGSLAHAQLDIPELQRRGLQLLASES
KDFRLLAHLLRTLQHAGDPLLALHLLTLYVEHYWTVAAPQNMAHKKRFASQIIKRFETGIEGFSQNAATT
QRDTLLGELAKLAQCWQSHNVPELAQATDDLFALYQRTFNRAAPAPVPTPAASGSSPQTTVTSESGVTQP
SAPAPQIAIDSHDDKAWRDTLLKVAAILCERQPDSPQGYRLRRHALWQSITSTPQAESDGRTPLAAVSAD
MVADYQSRLASADMALWQQVEKSVLLAPYWLDGHCLSAQTALRLGYKQVADTIRDEVIRFLERLPQLTGL
LFNDRTPFLSEQTKQWLAASPDGKVAPVAQIGEESQAARACFAGQGLEAALRYLDMLPEGDPRDQFHRQY
LAAQLTEEAGLIQLAQQQYRMLLMIGSQMMVSDWEPSLLTQLEQKFTAEQ
 
Nucleotide Sequence: 1413 bp     [Download]
>gi|254791136|ref|NC_013008.1|:c250365-248953 Escherichia coli O157:H7 str. TW14359 chromosome, complete genome
ATGGCAATGGACTTACGCGATCCGAATGTCTGGATATCGCACCTGCTGGAAAACCTGCCGGAAGAAAAAC
TGGCATCGGCGCTGAAAGATGACAACCCGGACTGGGAGTATATCGACGGCGAAATCGTCAAGCTGGGGTC
TCTGGCCCACGCTCAGCTTGATATTCCCGAACTACAACGCAGGGGGCTACAGCTTCTGGCTTCTGAAAGC
AAAGACTTCAGGCTACTGGCACACCTGCTCAGAACCCTGCAACATGCCGGTGATCCACTGCTGGCACTGC
ACCTGCTAACGCTATACGTGGAACATTACTGGACTGTGGCCGCGCCGCAGAATATGGCGCATAAAAAACG
CTTTGCCAGCCAGATCATTAAACGTTTTGAAACGGGTATTGAAGGCTTTTCACAAAACGCTGCCACAACG
CAGCGCGATACTCTGCTGGGTGAGCTGGCGAAACTGGCGCAGTGCTGGCAGTCACATAACGTCCCGGAAC
TGGCACAGGCTACCGATGATCTTTTTGCCCTGTACCAGCGTACGTTTAATCGTGCGGCTCCTGCTCCGGT
CCCCACTCCGGCGGCCTCCGGTAGTTCACCACAAACCACCGTCACGTCTGAAAGCGGCGTGACGCAACCC
AGTGCTCCGGCTCCCCAAATCGCCATCGACAGTCACGACGACAAAGCCTGGCGCGACACGCTGTTAAAAG
TGGCGGCTATTTTATGTGAACGCCAGCCGGACTCGCCGCAGGGCTATCGCCTGCGCCGCCATGCCCTGTG
GCAATCCATCACCAGTACACCCCAGGCGGAAAGCGATGGACGTACCCCACTGGCTGCGGTCTCTGCCGAT
ATGGTGGCGGATTACCAGTCCCGGCTTGCCAGCGCGGATATGGCGCTGTGGCAACAGGTTGAGAAAAGCG
TATTGCTGGCTCCTTACTGGCTGGACGGTCACTGTCTTTCTGCACAGACGGCACTGCGTCTGGGTTACAA
ACAGGTGGCAGACACCATCCGCGATGAGGTCATCCGCTTCCTTGAGCGTCTGCCCCAGCTTACCGGGCTG
CTGTTTAATGACCGCACACCGTTTCTCAGTGAGCAGACGAAACAATGGCTGGCTGCTTCGCCCGACGGCA
AAGTTGCACCGGTTGCGCAAATCGGTGAGGAATCGCAGGCAGCCAGAGCCTGTTTTGCTGGGCAGGGTCT
GGAGGCGGCGCTGCGATATCTGGACATGCTACCCGAAGGCGATCCCCGCGATCAGTTTCACCGCCAGTAC
CTTGCCGCACAGTTGACGGAGGAGGCGGGGCTGATACAGCTTGCGCAGCAACAGTACCGGATGTTGTTGA
TGATAGGGAGTCAGATGATGGTGTCTGACTGGGAGCCATCATTACTTACGCAGCTTGAACAAAAATTCAC
GGCAGAACAATAA
 Primer design