SecReT6
Protein ID: 254791350
SecReT6 ID360
T6SS typei1
Gene symbol-
Locus tagECSP_0223
StrainEscherichia coli O157:H7 str. TW14359
Repliconchromosome [GenBank: NC_013008] [Browse all T6SS(s) in this replicon]
Location [Strand]245382..248816 [-]
Productmacrophage toxin
NoteTssM
UniProt IDC6UWX0
KEGG IDetw:ECSP_0223
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 5.40E-85, Aligned region: 293..334
IcmF-related [PF06761], Evalue: 5.40E-85, Aligned region: 475..788
ImcF-related_N [PF14331], Evalue: 2.40E-62, Aligned region: 175..425
DUF1215 [PF06744], Evalue: 1.00E-33, Aligned region: 274..292
DUF1215 [PF06744], Evalue: 1.00E-33, Aligned region: 884..1003
AAA_22 [PF13401], Evalue: 0.00013, Aligned region: 110..243
AAA_22 [PF13401], Evalue: 0.00013, Aligned region: 826..857
Protein Sequence: 1144 a.a.     [Download]
>gi|254791350|ref|YP_003076187.1| macrophage toxin [Escherichia coli O157:H7 str. TW14359]
MLILAWIFLLVWIWWKGPTWTLYEEQWLKPLANRWLATAAWGIIALVWLTVRVMKRLQLLEKQQKQQREE
AIDPLSVELNAQQRYLDRWLLRLQRHLDNRRFLWQLPWYMVIGPAGSGKTTLLREGFPSDIIYAPEGARG
TEQRLYLTPHVGKQAVIFDIDGTLCAPADADILHRRLWEHALGWLKEKRARQPLNGIILTLDLPDLLTAD
KRHREHLLQTLRSRLQDIRQHLHCQLPVYVVLTRLDLLQGFAALFQSLNRQDRDAILGVTFTRRAHENDD
WRTELNAFWQTWVDRMNLALPDLMVTQTHTRASLFSFSRQMQGSREPLVSLLEGLLDGENMNVMLRGVYL
TSSLQRGQMDDIFTQSAARQYRLGNNPLASWPLVDTAPYFTRSLFPQALLAEPNLATESRAWLMRSRRRL
TVFSATGGVAALLLITGWHHYYNGNYQSGITVLKQAKAFMDVPPPQGEDDYGNLQLPLLNPVRDATLAYG
DWGDRSRLADMGLYQGRRIGPYVEQTYLQLLEQRYLPSLFNGLVKAMNAAPPESEEKLAVLRVMRMLEDK
SGRNNEVVKQYMAKRWSEKFHGQRDIQAQLMSHLDYALAHTDWHAERQAGDGDAISRWTPYDKPVVSAQK
ELSKLPVYQRVYQSLKTRALGVLPADLNLRDQVGPTFDQVFTSADDNKLVVPQFLTRYGLQSYFVKQRDE
LVELTAMDSWVLNLTRSVKYSDADRAEIQRQLTEQYISDYTATWRAGMDNLNIRNFESIGQLTGALEQVI
SGDQPLQRALTVLRDNTQPGVFSEKLSAKERDEALAEPDYQLLTRLGHEFAPENITLAVQKDKESTMQAV
YQQLTELHRYLLAIQNAPVPGKSALKAVQLRLDQNSSDPIFATRQMAKTLPAPLNRWVGRLTDQAWHVVM
VEAVHYMEVDWRDSVVKPFNEQLANNYPFNPRSAQDASLDAFERFFKPDGILDTFYQQNLKLFIDNDLSL
EDGDNNVIIREDIIAQLETAQKIRDIFFSKQNGLGTSFAVETVSLSGNKRRSVLNLDGQLVDYSQGRNYT
AHLVWPNNMREGNESKLTLIGTSGNAPRSISFSGPWAQFRLFGAGQLTGVQDGNFTVRFSVDGGAMTYRV
HTDTEDNPFSGGLFSQFGLSDTLY
 
Nucleotide Sequence: 3435 bp     [Download]
>gi|254791136|ref|NC_013008.1|:c248816-245382 Escherichia coli O157:H7 str. TW14359 chromosome, complete genome
TTGCTGATACTGGCGTGGATTTTTCTGCTGGTATGGATCTGGTGGAAAGGCCCGACGTGGACGCTGTATG
AAGAACAGTGGCTCAAACCACTGGCGAACCGCTGGCTGGCAACGGCGGCGTGGGGGATTATTGCCCTGGT
GTGGCTTACCGTCCGGGTAATGAAGCGCCTGCAACTGCTTGAAAAACAGCAAAAACAGCAGCGCGAAGAG
GCCATTGATCCGCTCAGTGTGGAGCTGAACGCCCAGCAGCGTTACCTTGACCGCTGGCTGCTGCGCCTGC
AACGCCATCTCGACAACCGCCGTTTCCTGTGGCAGTTACCGTGGTATATGGTCATCGGCCCGGCGGGCAG
TGGCAAAACGACACTGCTGCGCGAGGGGTTTCCGTCAGACATTATTTATGCCCCGGAGGGCGCGCGCGGC
ACAGAACAACGCCTGTACCTTACGCCCCATGTCGGTAAACAGGCGGTGATCTTTGATATCGACGGCACAC
TCTGCGCTCCCGCTGATGCGGATATCCTGCATCGCCGTCTGTGGGAACATGCCCTCGGCTGGCTGAAAGA
AAAGCGCGCGCGCCAGCCGCTGAACGGGATTATTCTGACACTCGATTTACCCGATCTGCTGACCGCAGAC
AAACGCCACCGCGAGCATCTGTTACAGACGCTGCGCAGCCGCTTACAGGATATACGCCAGCATCTTCACT
GCCAGTTACCGGTTTACGTGGTACTGACCCGGCTTGATTTATTACAGGGTTTTGCCGCCCTGTTCCAGTC
CCTGAACAGACAGGATCGCGATGCGATTCTGGGCGTCACGTTCACCCGCCGTGCCCATGAAAATGATGAC
TGGCGAACAGAGTTGAATGCTTTCTGGCAGACATGGGTGGATCGAATGAATCTGGCGTTGCCGGATCTGA
TGGTCACCCAGACTCACACCCGCGCGTCTTTATTCAGTTTTTCCCGCCAGATGCAGGGAAGCCGTGAACC
GCTGGTGTCACTGCTTGAGGGTCTGCTTGACGGTGAAAATATGAACGTGATGCTGCGTGGTGTCTATCTC
ACCTCTTCGCTTCAGCGCGGGCAGATGGATGATATATTCACCCAGTCTGCCGCCCGCCAGTACCGACTGG
GCAATAACCCACTGGCGTCCTGGCCTCTGGTGGACACCGCGCCTTATTTCACCCGCAGCTTGTTCCCGCA
GGCATTACTCGCAGAGCCTAATCTGGCAACGGAGAGCCGCGCCTGGCTGATGCGTTCCCGTCGCCGCCTG
ACGGTTTTCTCTGCCACCGGCGGCGTGGCGGCACTGCTGCTCATCACCGGCTGGCATCACTATTACAACG
GTAACTATCAGTCCGGCATCACCGTGCTTAAGCAGGCCAAAGCCTTTATGGATGTGCCGCCTCCACAGGG
GGAAGATGACTACGGCAACCTGCAACTGCCGCTGCTGAACCCGGTACGCGATGCCACACTGGCCTATGGC
GACTGGGGCGACCGCAGCCGTCTGGCCGATATGGGACTGTACCAGGGACGACGTATCGGACCTTATGTGG
AACAGACCTATCTGCAACTGCTGGAGCAACGTTACCTGCCCTCGCTGTTTAACGGGCTGGTTAAAGCGAT
GAATGCCGCGCCGCCGGAGAGTGAAGAAAAACTCGCGGTGCTGCGCGTGATGCGAATGCTGGAGGACAAA
AGCGGACGTAACAATGAGGTGGTGAAGCAGTATATGGCAAAACGCTGGAGCGAAAAGTTCCACGGCCAGC
GCGATATCCAGGCACAACTGATGTCCCATCTTGACTACGCGCTGGCTCATACTGACTGGCACGCAGAGCG
TCAGGCGGGCGACGGTGACGCCATCAGCCGCTGGACGCCATATGACAAGCCCGTGGTATCAGCACAGAAA
GAACTGAGCAAACTGCCTGTCTACCAGCGGGTTTACCAGAGCCTGAAAACGCGGGCGCTGGGCGTTCTTC
CTGCCGACCTCAATCTGCGTGACCAGGTAGGGCCAACCTTTGACCAGGTGTTTACATCTGCCGATGACAA
CAAACTGGTTGTTCCACAGTTTCTTACCCGTTACGGCCTGCAAAGCTATTTTGTAAAACAGCGCGATGAA
CTGGTTGAACTGACGGCGATGGATTCCTGGGTACTTAACCTTACCCGCAGCGTGAAATACAGTGACGCCG
ACCGCGCGGAAATCCAGCGCCAGCTCACCGAGCAGTATATCAGCGACTACACCGCCACCTGGCGGGCCGG
GATGGACAATCTGAATATCCGCAATTTTGAGTCCATCGGACAACTGACCGGGGCGCTGGAGCAGGTTATC
AGCGGCGACCAGCCTTTGCAGCGGGCGCTGACCGTGCTGCGTGACAACACACAGCCAGGCGTCTTTTCTG
AAAAACTCTCTGCCAAAGAACGGGATGAGGCCCTGGCAGAGCCGGACTACCAGTTACTCACCCGTCTCGG
GCATGAGTTCGCCCCGGAAAACATTACCCTGGCAGTACAGAAAGACAAAGAAAGCACGATGCAGGCCGTG
TATCAGCAACTCACCGAGTTGCACCGCTACCTGCTGGCAATCCAGAACGCGCCTGTACCAGGGAAATCGG
CGCTGAAAGCCGTGCAGTTACGGCTTGATCAGAACAGCAGCGATCCGATATTCGCCACCCGCCAGATGGC
AAAAACGCTGCCTGCTCCGCTCAACCGCTGGGTTGGCAGACTGACTGACCAGGCCTGGCATGTGGTGATG
GTGGAGGCTGTACATTATATGGAAGTGGACTGGCGCGACAGCGTGGTGAAACCGTTTAACGAGCAACTGG
CAAATAACTATCCGTTTAATCCGCGTTCTGCACAGGATGCCTCACTGGATGCCTTCGAACGCTTCTTTAA
ACCGGATGGCATACTGGATACCTTCTACCAGCAGAACCTGAAGCTGTTTATCGATAATGACCTGAGTCTG
GAGGATGGCGATAACAACGTCATTATTCGCGAAGATATTATTGCGCAACTGGAAACTGCGCAGAAAATCC
GTGACATCTTCTTCAGCAAACAGAACGGTCTGGGAACATCCTTTGCCGTGGAAACGGTATCGCTTTCAGG
CAATAAACGCCGCAGTGTACTGAACCTTGACGGTCAGTTAGTCGATTACAGCCAGGGCCGTAACTATACC
GCCCATCTGGTCTGGCCTAACAACATGCGCGAAGGCAACGAAAGTAAGCTGACGCTCATCGGCACCAGCG
GCAACGCGCCGCGCAGTATCAGCTTCAGCGGGCCGTGGGCGCAGTTCCGCCTGTTCGGGGCCGGACAACT
GACCGGAGTACAGGATGGCAACTTTACCGTGCGCTTTAGCGTGGACGGTGGCGCGATGACCTACCGTGTG
CATACCGACACGGAAGATAACCCGTTCAGCGGTGGGTTGTTCAGCCAGTTTGGTCTGTCAGACACACTGT
ACTGA
 Primer design