SecReT6
Protein ID: 254791353
SecReT6 ID360
T6SS typei1
Gene symbolclpV
Locus tagECSP_0226
StrainEscherichia coli O157:H7 str. TW14359
Repliconchromosome [GenBank: NC_013008] [Browse all T6SS(s) in this replicon]
Location [Strand]251110..253887 [-]
ProductHsp100/Clp ATPase
NoteTssH
UniProt IDC6UWX3
KEGG IDetw:ECSP_0226
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.10E-38, Aligned region: 224..242
AAA_2 [PF07724], Evalue: 1.10E-38, Aligned region: 648..809
AAA [PF00004], Evalue: 5.70E-17, Aligned region: 223..334
AAA [PF00004], Evalue: 5.70E-17, Aligned region: 654..771
AAA [PF00004], Evalue: 5.70E-17, Aligned region: 782..845
AAA_5 [PF07728], Evalue: 7.00E-14, Aligned region: 222..242
AAA_5 [PF07728], Evalue: 7.00E-14, Aligned region: 653..773
ClpB_D2-small [PF10431], Evalue: 1.20E-12, Aligned region: 815..891
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 19..46
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 199..239
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 264..300
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 422..499
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 624..694
AAA_16 [PF13191], Evalue: 4.50E-11, Aligned region: 719..747
AAA_22 [PF13401], Evalue: 1.30E-07, Aligned region: 221..307
AAA_22 [PF13401], Evalue: 1.30E-07, Aligned region: 447..482
AAA_22 [PF13401], Evalue: 1.30E-07, Aligned region: 652..687
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 222..246
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 456..487
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 648..682
AAA_25 [PF13481], Evalue: 3.20E-05, Aligned region: 780..845
AAA_29 [PF13555], Evalue: 6.50E-05, Aligned region: 166..181
AAA_29 [PF13555], Evalue: 6.50E-05, Aligned region: 214..240
AAA_29 [PF13555], Evalue: 6.50E-05, Aligned region: 651..678
AAA_14 [PF13173], Evalue: 9.20E-05, Aligned region: 222..321
AAA_14 [PF13173], Evalue: 9.20E-05, Aligned region: 653..743
NACHT [PF05729], Evalue: 9.30E-05, Aligned region: 222..249
NACHT [PF05729], Evalue: 9.30E-05, Aligned region: 283..345
NACHT [PF05729], Evalue: 9.30E-05, Aligned region: 654..682
AAA_19 [PF13245], Evalue: 0.00023, Aligned region: 219..243
AAA_19 [PF13245], Evalue: 0.00023, Aligned region: 647..675
DUF258 [PF03193], Evalue: 0.0003, Aligned region: 197..239
DUF258 [PF03193], Evalue: 0.0003, Aligned region: 654..672
AAA_18 [PF13238], Evalue: 0.0055, Aligned region: 223..242
AAA_18 [PF13238], Evalue: 0.0055, Aligned region: 654..688
IstB_IS21 [PF01695], Evalue: 0.0092, Aligned region: 216..244
IstB_IS21 [PF01695], Evalue: 0.0092, Aligned region: 653..664
AAA_17 [PF13207], Evalue: 0.0094, Aligned region: 222..263
AAA_17 [PF13207], Evalue: 0.0094, Aligned region: 654..688
Protein Sequence: 925 a.a.     [Download]
>gi|254791353|ref|YP_003076190.1| Hsp100/Clp ATPase [Escherichia coli O157:H7 str. TW14359]
MIQIDLPTLVKRLNLFSRQALEMAASECMSQQAAEITVSHVLIQMLAMPRSDLRVITRQGDIGMEELRQA
LTVENYTTARSADSYPAFSPMLVEWLKEGWLLASAEMQHSELRGGVLLLALLHSPLRYIPPAAARLLTGI
NRDRLQQDFVQWTQESAESVVPDADGKGAGTLTDASDTLLARYAKNMTEDARNGRLAPVLCRDHEIDLMI
DILCRRRKNNPVVVGEAGVGKSALIEGLALRIVAGQVPDKLKNTDIMTLDLGALQAGASVKGEFEKRFKG
LMAEVISSPVPVILFIDEAHTLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSR
RFQLVKVSEPNAAEATIILRGLSAVYERSHGVLIDDDALQAAATLSERYLSGRQLPDKAIDVLDTACARV
AINLSSPPKQISALTTLSHQQEAEIRQLERELRIGLRTDTSRMTEVLVQYDETLTALDELEAAWHQQQTL
VREIIALRQQLLGVAEDDAAPLPDADTVEDTQPESESESESEQDNTGAVPADETDREQPEETAETVSPVQ
RLAQLTAELDALHNDRLLVSPHVDKKQIAAVIAEWTGVPLNRLSQNEMSVITDLPKWLGDTIKGQDLAIA
SLHKHLLTARADLRRPGRPLGAFLLAGPSGVGKTETVLQLAELLYGGRQYLTTINMSEFQEKHTVSRLIG
SPPGYVGYGEGGVLTEAIRQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGEMADGEGRLIDCKNIVFFLTS
NLGYQVIVEHADDPETMQEALYPVLADFFKPALLARMEVVPYLPLSKETLATIIAGKLARLDNVLRSRFG
AEVVIEPEVTDEIMSRVTRAENGARMLESVIDGDMLPPLSLLLLQKMAANTAIARIRLSAVDGAFTADVE
DAQNDESVTKDETVL
 
Nucleotide Sequence: 2778 bp     [Download]
>gi|254791136|ref|NC_013008.1|:c253887-251110 Escherichia coli O157:H7 str. TW14359 chromosome, complete genome
ATGATCCAGATTGATCTTCCCACGCTGGTAAAACGGCTGAACCTGTTCTCCCGCCAGGCGCTGGAGATGG
CCGCCTCAGAATGTATGAGCCAGCAGGCAGCGGAAATTACCGTCAGCCATGTGCTTATTCAGATGCTCGC
CATGCCACGCAGTGACCTGCGGGTTATTACCCGCCAGGGCGATATTGGCATGGAAGAGTTGCGCCAGGCG
TTGACGGTAGAGAACTACACAACCGCCCGTTCTGCGGACAGCTACCCGGCGTTTTCCCCGATGCTGGTTG
AGTGGCTTAAAGAGGGCTGGCTGCTGGCGTCGGCTGAGATGCAGCACAGCGAACTGCGCGGCGGCGTGTT
GCTGCTGGCCTTGCTGCATTCGCCGCTGCGTTATATACCGCCTGCTGCCGCCCGGCTGTTGACCGGCATT
AACCGTGACCGTCTGCAACAGGACTTTGTGCAGTGGACACAGGAGTCGGCGGAATCAGTCGTGCCGGATG
CAGACGGTAAAGGCGCAGGCACACTGACGGACGCCTCTGACACCCTGCTTGCCCGCTACGCCAAAAACAT
GACAGAAGACGCCCGTAACGGCAGGCTAGCCCCAGTACTGTGCCGCGACCACGAAATCGACCTGATGATC
GACATTCTCTGCCGCCGCCGTAAAAACAACCCGGTGGTGGTGGGCGAAGCAGGCGTGGGTAAAAGCGCGC
TGATTGAAGGGCTGGCGCTGCGCATCGTGGCAGGCCAGGTGCCGGACAAACTGAAAAACACCGATATCAT
GACCCTTGACCTGGGCGCATTGCAGGCCGGGGCATCGGTGAAGGGTGAGTTTGAAAAACGCTTCAAGGGG
CTGATGGCGGAGGTCATTTCCTCTCCGGTGCCGGTCATTCTGTTTATCGACGAAGCGCATACCCTGATTG
GCGCGGGCAACCAGCAGGGCGGGCTGGATATCTCCAACCTGCTGAAACCGGCGCTGGCGCGTGGCGAACT
GAAAACCATCGCCGCCACCACCTGGAGCGAGTACAAAAAATACTTCGAGAAAGACGCCGCCCTGTCGCGC
CGCTTCCAGTTAGTGAAGGTCAGCGAACCCAACGCTGCCGAAGCCACCATTATTCTGCGTGGTCTGTCGG
CGGTCTATGAACGGTCTCACGGCGTGCTGATTGACGATGATGCCTTGCAGGCCGCAGCAACGCTGAGCGA
ACGTTATCTCTCCGGGCGTCAGTTACCGGACAAAGCGATTGATGTGCTGGATACCGCCTGCGCCCGTGTG
GCCATCAACCTGTCGTCGCCGCCGAAGCAAATCTCGGCGCTGACCACTCTGAGCCACCAGCAGGAGGCGG
AAATTCGCCAGCTTGAGCGCGAGCTTCGCATCGGACTGCGTACCGACACATCACGGATGACCGAGGTGCT
GGTGCAGTATGATGAAACGCTGACGGCGCTGGATGAACTGGAAGCGGCTTGGCACCAGCAGCAGACGCTG
GTCCGGGAGATTATCGCGCTGCGCCAGCAGTTACTGGGCGTGGCAGAGGACGATGCGGCGCCGTTGCCGG
ACGCAGATACTGTGGAGGATACGCAGCCAGAGTCAGAGTCAGAGTCAGAGTCAGAACAGGATAATACCGG
TGCCGTACCGGCTGATGAGACCGACAGAGAACAGCCGGAAGAGACCGCTGAAACAGTTTCCCCGGTACAG
CGGCTGGCCCAGCTCACTGCCGAACTGGACGCCCTGCATAACGACCGGTTGCTGGTCTCCCCGCACGTCG
ATAAAAAACAGATTGCGGCGGTGATTGCCGAATGGACCGGCGTGCCGCTCAACCGCCTGTCGCAGAATGA
AATGTCGGTCATCACCGACCTGCCGAAATGGCTGGGCGACACCATCAAAGGCCAGGACCTGGCGATTGCC
AGCCTGCATAAGCATCTACTGACCGCACGCGCCGACCTGCGTCGTCCGGGACGCCCGCTCGGTGCGTTCC
TGCTCGCTGGCCCCAGCGGCGTGGGTAAAACCGAAACCGTCCTGCAACTGGCAGAGCTGCTCTACGGCGG
TCGCCAGTACCTGACCACCATCAATATGTCCGAGTTCCAGGAGAAACACACCGTTTCGCGGCTGATTGGC
TCCCCTCCGGGCTATGTCGGCTATGGCGAAGGCGGCGTGCTGACTGAAGCCATCCGCCAGAAACCCTACT
CGGTGGTGCTGCTCGATGAAGTGGAAAAAGCGCACCCGGATGTCCTCAACCTGTTCTACCAGGCGTTTGA
CAAGGGCGAGATGGCCGACGGCGAAGGCCGCCTGATTGACTGTAAAAACATCGTCTTCTTCCTCACCTCC
AACCTCGGTTACCAGGTGATTGTCGAACACGCGGATGACCCGGAAACCATGCAGGAAGCCCTCTATCCGG
TGCTGGCGGACTTCTTTAAACCTGCCCTGCTGGCGCGAATGGAGGTGGTGCCGTACCTGCCGCTGTCGAA
AGAGACGCTCGCCACCATTATCGCCGGGAAACTGGCCCGTCTGGATAACGTGCTGCGCAGTCGCTTTGGT
GCAGAAGTGGTCATTGAACCGGAAGTGACGGACGAAATCATGAGCCGCGTCACCCGCGCGGAAAACGGCG
CGAGGATGCTGGAATCTGTCATCGATGGCGACATGCTACCGCCGCTCTCGCTGCTGCTGTTGCAGAAAAT
GGCGGCTAACACGGCGATTGCCCGGATTCGGTTGTCGGCAGTGGACGGCGCATTTACGGCAGACGTGGAA
GATGCTCAGAACGACGAGTCCGTCACAAAGGATGAAACGGTTTTATGA
 Primer design