SecReT6
Protein ID: 254791354
SecReT6 ID360
T6SS typei1
Gene symbol-
Locus tagECSP_0227
StrainEscherichia coli O157:H7 str. TW14359
Repliconchromosome [GenBank: NC_013008] [Browse all T6SS(s) in this replicon]
Location [Strand]253896..254657 [-]
Producthypothetical protein
NoteTssL
UniProt IDC6UWX4
KEGG IDetw:ECSP_0227
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.20E-62, Aligned region: 32..236
Protein Sequence: 253 a.a.     [Download]
>gi|254791354|ref|YP_003076191.1| hypothetical protein ECSP_0227 [Escherichia coli O157:H7 str. TW14359]
MDEGSLSLPPFTGYDEKSLRDYHLALHGNSLNPMIDAATPLLGMVMRLSTMNSQTMPEHLFAQVVTDVQA
VEQLLQEQGYEPGVIISFRYILCTFIDEAALGNGWSNKNEWIKQSLLVHFHNEAWGGEKVFILLERLIRE
PKRYQDLLEFLWLCFSLGFRGRYKVAVQDQGEFEQIYRRLYHVLHKLRGDAPFPLLHQDKKTQGGRYQLI
SRLTVKHIFCGGVVVLALFYLFYLLRLDSQTQDILHQLNKLLR
 
Nucleotide Sequence: 762 bp     [Download]
>gi|254791136|ref|NC_013008.1|:c254657-253896 Escherichia coli O157:H7 str. TW14359 chromosome, complete genome
ATGGATGAGGGGTCACTGTCTCTGCCACCATTTACCGGATACGACGAAAAAAGCCTGCGCGACTACCATC
TCGCGCTTCATGGCAACAGCCTGAATCCGATGATCGACGCGGCGACGCCGCTACTCGGTATGGTAATGCG
CCTTTCCACCATGAACAGCCAGACGATGCCGGAGCATCTTTTTGCTCAGGTGGTGACAGATGTTCAGGCC
GTGGAGCAACTGCTTCAGGAACAGGGCTACGAACCGGGCGTGATTATCTCGTTTCGCTACATCCTCTGCA
CGTTTATTGATGAAGCGGCGCTCGGTAACGGCTGGTCGAACAAGAACGAGTGGATCAAGCAGTCATTGCT
GGTCCATTTCCACAACGAAGCCTGGGGTGGCGAGAAAGTTTTCATCCTGCTGGAGCGCCTGATCCGTGAA
CCCAAACGTTACCAGGATCTGCTGGAATTTCTCTGGCTCTGTTTTTCTCTGGGATTTCGCGGGCGCTACA
AAGTGGCAGTACAGGATCAGGGGGAATTTGAGCAGATCTACCGCCGTCTGTACCACGTTCTGCATAAACT
GCGCGGCGATGCCCCTTTCCCGCTGTTACACCAGGACAAAAAAACCCAAGGCGGGCGTTATCAGCTCATC
AGTCGCCTGACTGTTAAACATATTTTTTGTGGTGGCGTTGTCGTGCTGGCGTTGTTTTACCTGTTCTATC
TGTTGCGGCTGGACAGCCAGACGCAGGACATCCTGCACCAGCTAAACAAATTACTTCGATAA
 Primer design