SecReT6
Protein ID: 254791357
SecReT6 ID360
T6SS typei1
Gene symbol-
Locus tagECSP_0230
StrainEscherichia coli O157:H7 str. TW14359
Repliconchromosome [GenBank: NC_013008] [Browse all T6SS(s) in this replicon]
Location [Strand]256517..257818 [-]
Producthypothetical protein
NoteFha
UniProt IDC6UWX7
KEGG IDetw:ECSP_0230
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 433 a.a.     [Download]
>gi|254791357|ref|YP_003076194.1| hypothetical protein ECSP_0230 [Escherichia coli O157:H7 str. TW14359]
MIITEQNMPEEKLQTLSLQVINGSELESGRAARCLFTQQGNVGHAPECHWSVQDRQQSIPAQAFTVILHD
GTFCLRPQTAQLWLNQAKVTATSDLIQLRQGDEIQIGRLMVRVHLNRGDIPHYDEEMATPETIVTNRDML
TDTLLSTEGAPHYPGMTHRHQLADTVVNGFSADPLQALQSESLITTGDPLSGIAAVRPSAPLSDPASNGG
INTPFMDLPPIYASPGDHNDDISAAEMAQRHLAVTPLLRGLGGSLTVSNSDDADDFLEEAGRTLQAAIKG
LLDLQQQRNSLSDKHLRPLEDNPLRLNMDYATALDVMFAEGKSPVHLAAPAAVSESLRNVRHHEEANRAA
IVESLRVLLDAFSPQNLLRRFVQYRRSHELRQPLDDAGAWQMYSHYYEELASDRQQGFEMLFNEVYAQVY
DRVLREKQREPEA
 
Nucleotide Sequence: 1302 bp     [Download]
>gi|254791136|ref|NC_013008.1|:c257818-256517 Escherichia coli O157:H7 str. TW14359 chromosome, complete genome
ATGATAATCACGGAGCAGAATATGCCGGAAGAGAAACTACAGACGCTTTCATTGCAGGTCATTAACGGCA
GTGAGCTGGAAAGCGGGCGGGCGGCGCGCTGTCTGTTCACACAGCAGGGAAATGTCGGCCATGCCCCCGA
ATGCCACTGGTCGGTACAGGATCGTCAGCAGAGCATTCCGGCCCAGGCTTTTACCGTTATCCTGCACGAT
GGCACATTTTGTCTACGCCCGCAGACGGCACAACTGTGGCTGAATCAGGCAAAAGTCACAGCAACATCAG
ACCTGATACAGTTGCGCCAGGGCGATGAGATCCAGATCGGACGGCTGATGGTGAGGGTTCATCTGAACCG
GGGAGATATTCCCCATTACGATGAGGAAATGGCCACTCCCGAAACCATCGTTACCAATCGCGATATGCTC
ACGGATACCCTGCTATCAACGGAGGGTGCGCCACACTATCCGGGAATGACTCACCGGCACCAGCTTGCAG
ACACCGTGGTAAATGGTTTTTCTGCCGATCCACTCCAGGCACTTCAGTCCGAAAGCCTGATTACCACGGG
CGATCCGCTTTCAGGCATTGCGGCTGTCCGGCCATCGGCACCGCTGTCCGATCCGGCAAGTAATGGGGGG
ATCAATACTCCGTTTATGGATCTGCCGCCCATTTATGCCAGCCCTGGCGATCATAATGATGACATCTCTG
CGGCAGAAATGGCGCAACGCCACCTTGCGGTCACCCCCTTACTGCGCGGTCTTGGCGGCTCGCTTACCGT
GAGCAATTCCGACGATGCGGATGATTTTCTGGAGGAGGCCGGACGAACGTTACAGGCCGCAATAAAAGGT
CTGCTCGATTTGCAGCAGCAGCGTAACAGCCTCTCAGACAAACATTTGCGCCCGCTGGAAGATAACCCGC
TGCGCCTGAACATGGATTACGCCACCGCGCTCGACGTGATGTTTGCCGAAGGTAAAAGCCCGGTACATCT
GGCGGCTCCCGCCGCCGTCAGTGAAAGCCTGCGCAATGTCCGCCACCACGAAGAAGCTAACCGGGCGGCG
ATTGTGGAGTCGCTTCGTGTCCTGCTGGATGCTTTCTCACCACAAAATCTGCTGCGCCGCTTTGTGCAGT
ACCGCCGCAGCCATGAACTGCGCCAGCCGCTGGATGATGCCGGAGCATGGCAAATGTACAGCCATTATTA
CGAAGAACTGGCCTCCGATCGCCAGCAGGGGTTTGAGATGCTGTTTAACGAGGTCTACGCCCAGGTCTAT
GACCGGGTGCTTCGTGAAAAACAGCGGGAGCCGGAAGCATGA
 Primer design