SecReT6
Protein ID: 254791361
SecReT6 ID360
T6SS typei1
Gene symbol-
Locus tagECSP_0234
StrainEscherichia coli O157:H7 str. TW14359
Repliconchromosome [GenBank: NC_013008] [Browse all T6SS(s) in this replicon]
Location [Strand]261226..262617 [-]
Producthypothetical protein
NoteTssC
UniProt IDC6UWY1
KEGG IDetw:ECSP_0234
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.00E-178, Aligned region: 68..463
Protein Sequence: 463 a.a.     [Download]
>gi|254791361|ref|YP_003076198.1| hypothetical protein ECSP_0234 [Escherichia coli O157:H7 str. TW14359]
MSLQEEELVSSHAGQPEQESSLLDQIMAQTRIQPGSEGYDVARQGVTAFIASILQSTASAEPVNKLAVDS
MIADIDERISRQMDVIIHAPAFQQVESFWRSLKTMVDRVDFRENIKVNVLHVTKQELLEDFEFAPEIIQS
GFYKHVYSSGFGQFGGEPIAAVLGAYEFKNTAPDMKLLQYVSAVGAMAHAPFLSSVSPEFMGLNSWTELP
NIKDLYAIFEGPAYTKWRALRDSEDSRYLGLTAPRFLLRQPYSPTDNPVKNFNYYEDVSQNHEDYLWGNT
AWMLACNIADSFAKYRWCPNIIGPQSGGAVKDLPVHLFETMGQIQAKIPTEVLVTDRREFELAEEGFITL
TMRKDSDNAAFFSANSVQKPKHFPGKDAETNYKLGTQLPYLFIINRLAHYIKVLQREQLGSWKERSDLER
ELNTWIRQYVADQENPPADVRSRKPLRAAKVEVMDVEGEPGWY
 
Nucleotide Sequence: 1392 bp     [Download]
>gi|254791136|ref|NC_013008.1|:c262617-261226 Escherichia coli O157:H7 str. TW14359 chromosome, complete genome
ATGTCTTTACAGGAAGAGGAACTCGTTTCCAGTCATGCCGGGCAGCCTGAGCAGGAATCGTCGCTGCTTG
ATCAAATCATGGCACAGACCCGTATTCAGCCCGGTTCGGAAGGTTATGACGTTGCCCGCCAGGGTGTGAC
AGCCTTTATTGCCAGCATCCTGCAATCCACTGCATCTGCCGAACCGGTCAATAAACTGGCCGTGGACAGC
ATGATTGCAGATATTGATGAACGCATCAGCCGCCAGATGGATGTCATCATCCATGCGCCTGCCTTTCAGC
AGGTCGAGTCGTTCTGGCGCTCACTGAAAACCATGGTGGATCGCGTTGATTTCCGTGAAAACATCAAGGT
CAACGTGCTTCATGTCACCAAGCAGGAACTTCTGGAAGACTTTGAGTTTGCGCCAGAAATTATTCAGTCC
GGATTTTATAAGCACGTTTATTCGTCCGGTTTCGGACAGTTTGGCGGTGAACCCATCGCTGCCGTGCTGG
GCGCTTATGAGTTCAAAAATACCGCGCCTGACATGAAACTGCTGCAATACGTCAGTGCCGTGGGCGCAAT
GGCGCACGCACCGTTCCTGTCCTCCGTTTCCCCGGAGTTTATGGGGCTGAACTCGTGGACCGAACTGCCT
AATATCAAAGATCTTTATGCCATCTTTGAAGGTCCGGCCTACACCAAATGGCGCGCCCTGCGTGACTCGG
AAGATTCGCGCTATTTAGGGCTTACGGCACCCCGCTTCCTGCTTCGCCAGCCCTATTCACCAACAGATAA
CCCTGTTAAGAACTTTAACTATTACGAAGATGTCAGCCAGAACCACGAAGATTATCTGTGGGGTAATACG
GCCTGGATGCTGGCATGCAATATCGCAGACAGTTTTGCCAAATACCGCTGGTGTCCAAACATTATCGGTC
CGCAAAGCGGCGGCGCAGTGAAAGATCTGCCGGTGCATCTGTTCGAAACGATGGGGCAGATTCAGGCCAA
AATCCCAACCGAGGTGCTGGTCACCGATCGCCGCGAATTTGAACTGGCTGAAGAGGGTTTTATCACCCTT
ACCATGCGTAAAGACTCTGATAATGCAGCCTTTTTCTCTGCAAACTCGGTACAAAAACCGAAGCACTTTC
CGGGAAAAGATGCAGAAACCAACTATAAGCTGGGTACGCAGCTTCCTTATCTCTTCATCATCAATCGGTT
AGCGCACTACATCAAGGTGTTGCAGCGTGAACAACTGGGGTCATGGAAAGAAAGGAGCGACTTAGAAAGA
GAGCTTAATACCTGGATCCGTCAGTATGTTGCCGACCAGGAAAACCCGCCTGCAGACGTGCGCAGCCGCA
AACCTCTGCGCGCTGCCAAAGTTGAGGTTATGGATGTAGAAGGCGAACCCGGCTGGTACTAG
 Primer design