SecReT6
Protein ID: 254791363
SecReT6 ID360
T6SS typei1
Gene symbol-
Locus tagECSP_0236
StrainEscherichia coli O157:H7 str. TW14359
Repliconchromosome [GenBank: NC_013008] [Browse all T6SS(s) in this replicon]
Location [Strand]262927..263427 [-]
Producthypothetical protein
NoteTssB
UniProt IDC6UWY3
KEGG IDetw:ECSP_0236
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.70E-55, Aligned region: 7..162
Protein Sequence: 166 a.a.     [Download]
>gi|254791363|ref|YP_003076200.1| hypothetical protein ECSP_0236 [Escherichia coli O157:H7 str. TW14359]
MSKKFEGSVAPRERINISYVPKTDGQTAEVELPLNMLVVGDTGNTQETSSLDERQAVSVNKHNFGAVMAE
AAIGLNFTVPATLKGSTTDDEMNVALNIKSLDDFSPDSVARQVPEVNKLLELREALTALKGPMGNLPAFR
TQLQALLENEESREQLLKEIGQVSNK
 
Nucleotide Sequence: 501 bp     [Download]
>gi|254791136|ref|NC_013008.1|:c263427-262927 Escherichia coli O157:H7 str. TW14359 chromosome, complete genome
ATGAGCAAAAAATTTGAAGGCAGCGTCGCGCCTCGCGAACGTATTAATATATCGTATGTCCCAAAAACAG
ATGGCCAGACGGCTGAAGTGGAACTTCCGCTTAACATGCTCGTTGTCGGCGATACCGGAAATACGCAGGA
AACATCCTCACTGGATGAACGTCAGGCAGTTTCCGTTAACAAGCACAATTTCGGTGCAGTGATGGCTGAA
GCAGCCATTGGCCTCAATTTTACCGTCCCCGCCACGCTGAAGGGAAGCACAACGGACGATGAAATGAATG
TGGCGCTGAATATCAAGTCACTGGATGATTTTTCACCAGATAGCGTGGCCCGGCAGGTTCCGGAAGTGAA
TAAATTGCTGGAACTGCGTGAAGCACTGACTGCACTGAAGGGGCCGATGGGTAACCTTCCGGCATTCCGT
ACCCAGCTCCAGGCATTGCTGGAAAATGAAGAGTCCCGCGAGCAGTTGCTCAAAGAAATCGGCCAGGTGA
GCAATAAATAA
 Primer design