SecReT6
Protein ID: 254791368
SecReT6 ID360
T6SS typei1
Gene symbol-
Locus tagECSP_0241
StrainEscherichia coli O157:H7 str. TW14359
Repliconchromosome [GenBank: NC_013008] [Browse all T6SS(s) in this replicon]
Location [Strand]267069..271301 [+]
Producthypothetical protein
NotePAAR
UniProt IDC6UWY8
KEGG IDetw:ECSP_0241
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 8.60E-67, Aligned region: 229..243
RHS_repeat [PF05593], Evalue: 8.60E-67, Aligned region: 325..361
RHS_repeat [PF05593], Evalue: 8.60E-67, Aligned region: 353..384
RHS_repeat [PF05593], Evalue: 8.60E-67, Aligned region: 434..472
RHS_repeat [PF05593], Evalue: 8.60E-67, Aligned region: 458..492
RHS_repeat [PF05593], Evalue: 8.60E-67, Aligned region: 498..537
RHS_repeat [PF05593], Evalue: 8.60E-67, Aligned region: 542..577
RHS_repeat [PF05593], Evalue: 8.60E-67, Aligned region: 584..620
RHS_repeat [PF05593], Evalue: 8.60E-67, Aligned region: 626..661
RHS_repeat [PF05593], Evalue: 8.60E-67, Aligned region: 667..697
RHS_repeat [PF05593], Evalue: 8.60E-67, Aligned region: 692..718
RHS_repeat [PF05593], Evalue: 8.60E-67, Aligned region: 729..762
RHS_repeat [PF05593], Evalue: 8.60E-67, Aligned region: 784..806
RHS_repeat [PF05593], Evalue: 8.60E-67, Aligned region: 870..903
RHS_repeat [PF05593], Evalue: 8.60E-67, Aligned region: 950..987
RHS_repeat [PF05593], Evalue: 8.60E-67, Aligned region: 1002..1013
RHS_repeat [PF05593], Evalue: 8.60E-67, Aligned region: 1035..1048
RHS_repeat [PF05593], Evalue: 8.60E-67, Aligned region: 1152..1170
RHS_repeat [PF05593], Evalue: 8.60E-67, Aligned region: 1165..1189
RHS [PF03527], Evalue: 8.40E-21, Aligned region: 625..635
RHS [PF03527], Evalue: 8.40E-21, Aligned region: 949..958
RHS [PF03527], Evalue: 8.40E-21, Aligned region: 1149..1189
Protein Sequence: 1410 a.a.     [Download]
>gi|254791368|ref|YP_003076205.1| hypothetical protein ECSP_0241 [Escherichia coli O157:H7 str. TW14359]
MGGKPAARQGDMTRKGLDIVQGSAGVLIGAPTGVACSVCPGGITYANPVNPVLGAKVLPGETDLALPGPL
PFILSRAYSSYRTRTPAPVGVFGPGWKAPFDIRLQIRDEGLILNDNGGRSIHFEPLFPGEISYSRSESFW
LARGGVAEQHSSQPLSALWQVLPEDVRLSPHMYLATNSLQGPWWILNWPERVPGADEVLPPEPPAYRVLT
GVVDGFGRTLAFHRAAEGDVAGAVTGVTDGAGRRFHLVLTTQAQRAEVFRKQRATSLSSPAGPRSASSSL
VFPDTLPAGTEYGADNGIRLEAVWLTHDPAYPDELPAAPLARYTYTASGELRAVYDRSGTQVRGFAYDAE
HAGRMVAHHYAGRPESRYRYDDTGRVTELVNPEGLDYRFEYGQDRVTITDSLNRREVLYTEGEGGLKRVV
KKEHADGSITRSEYDEAGRLKAQTDAAGRRTEYSLHMASGAVTAVTGPDGRTVRYGYNSQRQVTSVTYPD
GLRSSREYDEKGRLAAETSRSGETTRYSYDDPASELPTGIQDATGSTKQMAWSRYGQLLTFTDCSGYTTR
YEYDRYGQQIAVHREEGISTYSSYNPRGQLVSQKDAQGRETRYEYSAAGDLTAIVAPDGSRSEIQYDAWG
KAVSTTQGGLTRSMGYDAAGRITVLTNENGSQSTFRYDPVDRLTEQRGFDGRTQRYHYDLTGKLTQSEDE
GLVTLWHYDASDRITHRTVNGDPAEQWQYDEHGWLTTLSHTSEGHRVSVHYGYDDKGRLTGERQTVENPE
TGEMLWEHETGHAYSEQGLATRQEPDGLPPVEWLTYGSGYLAGMKLGGTPLVEYMRDRLHRETARSFGGE
AYELATAWNTSGQLRSRHLNLPQLDRDYDWNDNGQLIRISGPQESREYRYSDTGRLTGVHTTAANLDIDI
PYATDPAGNRLPDPELHPDSTLTAWPDNRIAEDAHYIYRYDEYGRLAEKTDRIPEGVIRMHDERTHHYHY
DSQHRLVFHTRIQHGEPQVESRYLYDPLGRRTGKRVWRRERDLTGWMSLSRKPEETWYGWDGDRLTTVQT
QQTRIQTVYQPGSFTPLLRIETENGEQAKARHRSLAEVLQEDTGVTLPAELAVMLGRLERELRQGSVSEE
SQQWLAQCGLTAEQMAAQLEAEYIPERKLHLYHCDHRGLPQALISPEGETAWQGEYDEWGNLLGETSAQH
LQQPYRLPGQQYDEESGLYYNRHRYYDPLQGRYITQDPIDIKGGWNLYSYALNPVSWIDPLGLTQCDSEG
CNNDILFTGGSGPDNKILNELGPRDGIDGLGSQNMKMYSGLLGGDILKPGILGGLTLGSVTQRPSRTAEE
EVQAQIEYLAYKKRCEQKPDSNLSRCAAAIFQKSRKEDCLRMRQEWDDKWWPGKHADEIKNVKASLKNTL
IDVKKKMHAN
 
Nucleotide Sequence: 4233 bp     [Download]
>gi|254791136|ref|NC_013008.1|:267069-271301 Escherichia coli O157:H7 str. TW14359 chromosome, complete genome
ATGGGAGGAAAACCGGCGGCGCGGCAGGGTGACATGACCCGCAAGGGACTGGATATTGTGCAGGGTTCAG
CAGGGGTGCTGATAGGTGCGCCGACGGGCGTGGCCTGCTCGGTGTGTCCGGGAGGGATTACCTATGCTAA
CCCGGTGAACCCGGTGCTGGGTGCGAAGGTGCTGCCGGGCGAGACGGACCTTGCGCTGCCCGGCCCGCTG
CCGTTTATTCTTTCCCGCGCCTACAGCAGCTACCGGACCAGAACACCCGCGCCGGTGGGGGTGTTTGGTC
CCGGCTGGAAAGCGCCCTTCGATATCCGCTTACAGATACGCGATGAAGGCCTGATACTCAACGACAACGG
CGGCAGGAGCATTCACTTTGAGCCGCTGTTTCCCGGCGAGATAAGCTACAGCCGCAGCGAGTCGTTCTGG
CTGGCGCGGGGCGGGGTGGCGGAGCAGCACAGTTCGCAGCCGCTAAGCGCGCTCTGGCAGGTGCTGCCGG
AAGATGTTCGCCTGAGTCCGCATATGTACCTGGCGACAAACAGCCTTCAGGGGCCGTGGTGGATACTCAA
CTGGCCGGAGCGGGTGCCGGGGGCGGACGAGGTGCTGCCGCCGGAGCCGCCCGCATACCGGGTGCTGACG
GGCGTGGTGGATGGCTTCGGGCGGACGCTGGCCTTTCACCGGGCGGCGGAGGGTGATGTGGCGGGCGCGG
TGACGGGGGTGACGGACGGCGCGGGCCGCCGTTTTCACCTGGTGCTGACCACACAGGCACAGCGGGCGGA
AGTATTCCGTAAACAGCGCGCCACGTCTTTATCTTCCCCTGCCGGTCCCCGTTCTGCTTCCTCTTCTCTG
GTTTTCCCCGACACGCTGCCCGCCGGTACAGAATACGGTGCCGATAACGGTATCCGGCTGGAGGCGGTAT
GGCTGACACACGACCCGGCATACCCGGATGAACTGCCCGCCGCGCCGCTGGCGCGCTACACGTACACGGC
CAGCGGAGAACTGCGGGCGGTGTATGACCGCAGCGGGACGCAGGTGCGCGGGTTTGCTTATGATGCGGAG
CACGCCGGGCGGATGGTGGCGCACCATTATGCGGGTAGGCCGGAGAGCCGCTACCGGTATGATGATACCG
GCCGGGTGACGGAGCTGGTCAACCCGGAGGGGCTGGACTACCGCTTTGAGTACGGGCAGGACCGTGTGAC
CATCACGGACAGCCTGAACCGGCGGGAGGTGCTGTACACGGAAGGCGAGGGTGGCCTGAAACGTGTTGTG
AAGAAGGAACATGCGGACGGGAGCATCACCCGCAGCGAGTATGATGAGGCGGGGAGGCTGAAGGCACAGA
CGGATGCGGCGGGACGGCGGACGGAGTACAGCCTGCATATGGCGTCGGGTGCGGTGACAGCGGTGACGGG
GCCGGACGGCAGGACGGTGCGGTATGGCTATAACAGCCAGCGGCAGGTGACGTCAGTGACGTACCCGGAC
GGGCTGCGCAGCAGCCGGGAGTATGATGAGAAGGGAAGGCTGGCGGCGGAGACCTCGCGCAGCGGAGAGA
CGACGCGGTACAGCTATGATGACCCGGCGAGTGAGCTGCCGACAGGGATACAGGACGCGACGGGCAGTAC
AAAACAGATGGCATGGAGCCGTTACGGTCAGCTGCTGACCTTTACGGACTGCTCGGGGTACACGACGCGG
TATGAGTATGACCGGTACGGTCAACAAATCGCCGTTCACCGGGAAGAAGGCATCAGCACTTACAGCAGTT
ATAACCCGCGTGGCCAACTGGTCAGTCAGAAGGATGCGCAGGGGCGTGAAACCCGTTATGAGTACAGCGC
CGCAGGCGACCTCACCGCTATCGTTGCCCCGGACGGCAGCCGCAGTGAGATACAGTATGATGCGTGGGGA
AAGGCCGTCAGCACCACGCAGGGCGGTCTGACGCGCAGCATGGGGTATGACGCTGCCGGGCGCATCACCG
TGCTGACCAACGAGAACGGCAGCCAGTCCACGTTCCGGTATGACCCGGTGGACAGGCTGACTGAACAGCG
CGGTTTTGACGGCCGGACGCAACGTTACCACTATGACCTGACCGGAAAACTCACGCAGAGTGAAGACGAG
GGGCTTGTCACCCTCTGGCACTACGATGCGTCGGACCGCATCACGCACCGGACGGTGAACGGCGACCCGG
CAGAGCAGTGGCAGTATGATGAGCACGGGTGGCTAACCACCCTCAGCCATACCAGTGAAGGCCACCGGGT
GTCGGTCCACTACGGCTATGACGATAAAGGCCGCCTGACGGGTGAACGGCAGACGGTGGAGAACCCGGAG
ACGGGGGAGATGCTGTGGGAGCATGAGACGGGGCACGCGTACAGCGAACAGGGGCTGGCGACCCGTCAGG
AGCCGGACGGTCTGCCGCCGGTAGAGTGGCTGACGTATGGCAGCGGTTATCTTGCGGGGATGAAGCTGGG
CGGAACGCCACTGGTCGAGTACATGCGGGACCGGCTGCACCGTGAGACGGCCCGCAGCTTCGGCGGGGAG
GCATATGAACTTGCCACCGCCTGGAATACCAGCGGCCAGCTCCGGAGCAGGCACCTGAACCTTCCGCAGC
TTGACCGTGACTACGACTGGAACGACAACGGACAGCTAATCCGCATCAGCGGCCCGCAGGAGAGCCGGGA
GTACCGTTACAGTGACACGGGAAGGCTGACGGGCGTCCACACCACGGCAGCGAACCTGGATATCGATATC
CCGTATGCAACGGACCCGGCAGGAAACCGGCTGCCGGACCCGGAACTGCATCCGGACAGCACGCTCACGG
CGTGGCCGGATAACCGCATCGCGGAAGATGCGCACTATATCTATCGCTACGATGAATACGGCAGGCTGGC
GGAGAAGACGGACCGTATCCCGGAAGGGGTTATCCGGATGCACGACGAGCGCACCCACCACTATCACTAC
GACAGCCAGCACCGCCTGGTGTTCCACACGCGGATACAGCACGGCGAACCACAGGTGGAGAGCCGGTACC
TCTATGACCCGCTGGGCCGCCGGACGGGAAAACGGGTGTGGCGGCGGGAGCGTGACCTGACGGGGTGGAT
GTCGCTGTCGCGTAAACCGGAGGAGACCTGGTACGGGTGGGACGGTGACAGGCTGACCACTGTACAGACC
CAACAGACAAGAATCCAGACGGTATACCAGCCGGGAAGCTTCACGCCGCTCCTGAGAATCGAAACAGAGA
ATGGTGAACAGGCGAAGGCGCGGCACCGTAGCCTGGCGGAGGTGTTGCAGGAGGACACGGGTGTGACGCT
ACCGGCGGAGCTGGCGGTGATGCTGGGGAGGCTGGAGCGGGAACTGCGGCAGGGCAGCGTGAGTGAAGAA
AGCCAGCAGTGGCTTGCGCAGTGCGGGCTGACGGCGGAACAGATGGCCGCGCAGCTGGAGGCGGAATATA
TCCCGGAGCGGAAACTTCATCTTTACCACTGCGACCACCGGGGACTGCCGCAGGCGCTCATCAGCCCGGA
AGGGGAAACGGCGTGGCAGGGGGAGTATGACGAGTGGGGAAACCTGCTGGGCGAAACCAGCGCGCAGCAC
CTGCAACAGCCGTACCGTCTGCCGGGACAGCAGTATGATGAGGAGTCGGGGCTGTATTACAACCGTCACC
GGTACTATGACCCGCTACAGGGGAGGTATATCACCCAGGATCCAATAGATATAAAAGGAGGATGGAATTT
ATATTCTTATGCGCTTAATCCGGTAAGTTGGATTGACCCATTAGGATTGACGCAGTGCGATTCCGAAGGG
TGTAATAATGATATATTATTTACAGGAGGAAGTGGTCCCGATAATAAAATACTTAATGAATTAGGTCCGA
GAGATGGCATTGACGGTTTGGGTTCACAAAACATGAAAATGTATAGTGGGCTATTAGGGGGCGATATTTT
AAAACCGGGGATTCTGGGCGGTTTGACGCTTGGTAGTGTGACACAACGACCATCGCGAACGGCTGAGGAG
GAGGTGCAAGCTCAAATAGAATATTTAGCATATAAGAAGCGTTGTGAGCAAAAACCTGATAGTAATTTAA
GTCGTTGTGCTGCCGCGATCTTTCAAAAGAGCAGAAAAGAAGATTGTTTAAGAATGAGACAAGAATGGGA
TGATAAATGGTGGCCTGGCAAACATGCGGATGAAATAAAAAATGTGAAAGCATCGTTGAAAAACACACTT
ATTGATGTTAAAAAAAAGATGCATGCCAACTAG
 Primer design