SecReT6
Protein ID: 256823713
SecReT6 ID361
T6SS typei5
Gene symbol-
Locus tagKkor_2499
StrainKangiella koreensis DSM 16069
Repliconchromosome [GenBank: NC_013166] [Browse all T6SS(s) in this replicon]
Location [Strand]2700943..2704494 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDC7R9N9
KEGG IDkko:Kkor_2499
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 9.20E-90, Aligned region: 88..120
ImcF-related_N [PF14331], Evalue: 9.20E-90, Aligned region: 197..457
IcmF-related [PF06761], Evalue: 1.50E-67, Aligned region: 307..335
IcmF-related [PF06761], Evalue: 1.50E-67, Aligned region: 523..807
DUF1215 [PF06744], Evalue: 6.80E-32, Aligned region: 310..346
DUF1215 [PF06744], Evalue: 6.80E-32, Aligned region: 923..1042
Protein Sequence: 1183 a.a.     [Download]
>gi|256823713|ref|YP_003147676.1| unnamed protein product [Kangiella koreensis DSM 16069]
MSGTIRKIGKVITHKITITVLVVLAVIALVWFGGPLISIGGYEILASASARVSLLLIIACAWLGIKFWKL
HQASSKNKKLIEHISKEEQDQLEIEQSSDDEIAVLEKRMSDGLQYLKKSDFKGKNLYQLPWYVLIGPPGA
GKTTSIVNSGLNLPLAEEFGASPIKGIGGTRNCDWWFTDDAVLLDTAGRYTTQDSYREVDSRAWLGFLDL
LKKSRPMRPVNGAIVTISIEDLLQKTQSEVNELAGTIRKRIQELKMQLGVNIPVYLMLSKGDLLAGFNEL
FDDISRDEREEVFGFTFEVDEDFGHHYAAAKFNQYFVELIQKIERKLTKKLQSEKSEQRRALIYSFPRQL
RLAQKNIDDFIQVAFSQNRYEEPILLRGVYFTSATQEGTPINRIGREISNSFGFQRERSAASQIEGKGYF
IKRLLQDVIFKEDKLVGINISYQKRQRLIQRVGYAVAGFCLITLSYLWSHSYANNKQIIDSTSSLVSEYT
EASNGGITEQSNLVELNGGLNVLKRFSSQIVANKNALSEGFGLYQGDKFSGISSEVYSKGLTNYYGPYLK
GTLEKEMLQAKNHHDYLYELLRIYLMFYLPQHKEDKDIASLFEHLWRRDFPGEINEELRSDLKSHLNYFL
VQQMALPQQDGKLIEYAQNKLSKVSLVERVYNSLLDNYINAMPEFKPSDYLSQKVEGYFYRKSGKSLREG
IPGLYTQAGYHGVFKRESKKISEILSKDSWVLPSGETESLDKLSILDIQEQVRNKYFNDYIFYWKELIGD
VAVREFSTPEEGALMLQELTGVNAPIERLYSAIRDNVMLARPKAEGLDLDAAKDVVDSAGSSRVNNNINR
YERLIPDSADIDVVPEQVVNDAFGEIIHYVGDPGSASALKQSIGALKNMQIFLESISNANNAAEKTYEVT
SSPQAASIISELEKEASVTPQPMNEWLGKVENSGKTLTNTGTYSYLNNLWKTQVLAECRRAIEGRYPVNK
RSRQDITLDDFRSFFSYGGTIDRFFDEHLSVFVDTSRGRWRLLKDIGISNYTLRQLEKAKSIRESFFVRN
GSDISVNFTLKPSSLSVNAGQVLVDIEGQVLSYRHGPLRSYPTRWPGPKPQVATSISFTPANGGQTETVR
TSGFWGMFRLLDKAKLKKTLAYDKFLVEFKQAPFDATFELQAHSVNNPFFGSDLEGFNCPTDL
 
Nucleotide Sequence: 3552 bp     [Download]
>gi|256821228|ref|NC_013166.1|:c2704494-2700943 Kangiella koreensis DSM 16069 chromosome, complete genome
ATGTCAGGGACTATAAGAAAAATAGGTAAAGTAATAACACATAAAATCACCATAACGGTATTGGTGGTGC
TCGCAGTTATTGCTTTAGTATGGTTCGGTGGGCCTTTGATTAGTATTGGTGGCTATGAAATATTAGCCAG
CGCAAGTGCCCGAGTGAGTTTGTTGTTGATTATTGCATGTGCATGGCTGGGGATTAAATTCTGGAAGCTG
CATCAGGCGAGTAGTAAAAACAAAAAGCTCATTGAGCACATCTCAAAAGAAGAGCAGGATCAGCTCGAAA
TCGAACAGTCGTCGGATGATGAGATTGCAGTACTGGAGAAGCGTATGTCTGATGGGCTGCAATACCTCAA
GAAAAGCGACTTTAAAGGTAAAAACCTCTATCAATTACCCTGGTATGTTTTAATTGGCCCGCCCGGCGCC
GGTAAAACCACCAGCATCGTTAATTCTGGGCTAAACCTACCGCTGGCAGAAGAGTTTGGAGCTAGCCCGA
TTAAAGGTATTGGTGGCACCAGAAATTGTGATTGGTGGTTTACCGATGATGCAGTATTGCTGGACACCGC
TGGGCGATACACCACTCAAGATAGTTACCGAGAGGTTGACTCAAGAGCATGGCTGGGCTTTCTGGACTTG
TTAAAAAAGTCGCGACCAATGCGACCGGTTAACGGCGCAATTGTCACGATCAGCATTGAGGACTTGTTGC
AGAAAACGCAGTCTGAAGTCAATGAGCTGGCAGGAACTATTCGTAAAAGAATCCAGGAATTAAAAATGCA
GCTGGGAGTCAATATCCCGGTTTACTTAATGCTAAGCAAAGGTGATTTGTTGGCTGGCTTCAACGAGCTG
TTTGATGACATTTCACGTGACGAAAGAGAGGAAGTGTTTGGCTTCACTTTTGAAGTAGATGAAGATTTTG
GCCATCATTATGCGGCTGCAAAGTTTAATCAATATTTTGTAGAGTTGATTCAAAAGATTGAGCGGAAACT
GACAAAGAAACTGCAGTCCGAAAAAAGCGAGCAAAGACGAGCTCTGATTTATAGCTTCCCACGACAGCTA
CGTTTAGCACAAAAGAATATAGATGACTTTATTCAGGTGGCTTTTAGTCAGAACCGTTATGAAGAACCAA
TCTTGCTTAGAGGTGTTTATTTCACCAGCGCTACCCAGGAAGGTACGCCGATAAACCGTATTGGTCGTGA
GATATCCAATAGCTTCGGTTTTCAGCGAGAACGCAGCGCTGCAAGTCAGATAGAAGGTAAAGGTTATTTC
ATTAAGCGGCTTTTGCAGGATGTCATATTTAAGGAAGATAAACTGGTTGGGATTAATATCAGTTACCAGA
AAAGGCAGCGCCTGATTCAACGTGTTGGCTATGCAGTTGCTGGATTCTGTCTTATCACTTTGAGTTATCT
GTGGTCACACAGCTATGCTAATAATAAGCAGATTATCGATAGCACCTCTTCGTTAGTATCTGAATATACC
GAGGCCAGTAACGGTGGAATAACGGAGCAGTCTAACCTTGTTGAACTAAACGGTGGCCTTAATGTATTAA
AGAGATTTTCTAGCCAGATAGTGGCAAATAAGAATGCGCTAAGTGAGGGTTTTGGCCTGTACCAAGGGGA
CAAGTTTAGTGGTATCAGCAGCGAAGTATACAGTAAAGGATTGACTAATTATTATGGCCCTTATCTGAAA
GGGACCTTAGAAAAAGAAATGCTCCAGGCAAAAAATCATCATGACTATTTGTATGAACTGTTGCGAATAT
ATTTGATGTTCTACTTGCCACAGCATAAAGAAGATAAAGACATTGCTTCGCTATTTGAACACTTATGGCG
CAGAGACTTTCCAGGTGAAATCAACGAAGAACTCAGATCTGATCTTAAGTCCCACTTGAACTACTTTCTG
GTTCAACAAATGGCTCTACCACAGCAAGATGGCAAGTTGATTGAATATGCGCAAAACAAACTCAGCAAAG
TGTCTTTGGTAGAACGCGTTTATAACAGCCTGTTAGATAATTACATAAATGCCATGCCGGAATTTAAGCC
TAGCGACTATCTATCACAAAAAGTCGAAGGCTACTTCTACCGAAAAAGTGGTAAGTCGTTACGAGAAGGG
ATTCCCGGACTCTACACCCAGGCTGGTTATCACGGCGTGTTCAAAAGAGAGAGCAAAAAAATTAGTGAGA
TTCTGTCAAAAGACTCATGGGTACTTCCTTCTGGTGAGACTGAAAGCCTGGATAAACTTTCGATACTCGA
TATTCAGGAACAGGTTCGCAATAAATACTTCAATGACTATATCTTTTATTGGAAAGAGTTGATCGGTGAT
GTGGCTGTCAGAGAATTTTCTACACCTGAAGAAGGTGCTTTGATGCTGCAGGAGTTGACTGGGGTCAATG
CACCGATAGAAAGGCTGTACTCAGCTATCCGCGACAATGTCATGCTGGCAAGACCTAAAGCCGAGGGCTT
GGATCTTGATGCAGCTAAGGATGTGGTCGATTCAGCAGGTTCCTCTCGGGTTAATAACAATATTAATCGT
TATGAAAGACTTATTCCTGACAGTGCTGATATTGATGTGGTACCAGAGCAGGTGGTCAATGATGCATTTG
GTGAAATTATTCATTATGTGGGTGACCCCGGTAGTGCAAGTGCGTTAAAGCAAAGTATTGGTGCCCTCAA
GAATATGCAGATATTCCTGGAGTCAATTAGTAATGCTAATAATGCAGCAGAAAAAACCTATGAAGTGACC
AGTAGTCCGCAGGCAGCCAGCATTATCAGTGAGCTTGAAAAAGAAGCCAGCGTTACGCCACAACCGATGA
ATGAATGGTTGGGAAAAGTCGAAAATAGTGGCAAAACATTAACTAACACGGGTACCTATTCCTATCTGAA
TAATCTATGGAAGACACAGGTATTAGCTGAGTGTCGTCGAGCTATTGAAGGTAGATATCCGGTAAACAAA
AGAAGTCGTCAAGATATTACTCTGGATGATTTCAGAAGTTTCTTTTCCTATGGCGGTACCATTGACCGCT
TTTTTGATGAACACTTAAGTGTATTTGTGGACACATCTCGAGGTCGCTGGCGACTACTAAAAGATATTGG
CATCAGCAACTACACTTTAAGACAACTGGAAAAAGCCAAGTCAATCAGAGAAAGTTTCTTCGTTAGGAAT
GGCTCTGACATATCAGTCAACTTTACCTTAAAACCATCAAGCTTAAGTGTTAATGCAGGTCAGGTATTAG
TGGATATTGAAGGTCAGGTTTTGTCCTATCGACATGGCCCGTTACGCTCATACCCTACCCGCTGGCCAGG
GCCAAAACCACAAGTAGCAACATCGATATCCTTTACTCCTGCTAACGGCGGTCAGACTGAAACAGTCAGA
ACTTCGGGTTTTTGGGGTATGTTCAGATTGCTGGACAAGGCGAAGTTAAAGAAGACATTGGCTTATGACA
AGTTTCTCGTTGAATTCAAGCAGGCGCCATTTGACGCAACCTTTGAGTTGCAAGCCCACAGTGTTAACAA
CCCATTTTTTGGGTCTGACCTGGAAGGCTTTAACTGCCCGACGGATTTGTAA
 Primer design