SecReT6
Protein ID: 260595860
SecReT6 ID362
T6SS typei3
Gene symbol-
Locus tagCTU_00680
StrainCronobacter turicensis z3032
Repliconchromosome [GenBank: NC_013282] [Browse all T6SS(s) in this replicon]
Location [Strand]65522..69160 [+]
Producthypothetical protein
NoteTssM
UniProt IDC9Y415
KEGG IDctu:CTU_00680
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.10E-101, Aligned region: 213..490
ImcF-related_N [PF14331], Evalue: 1.10E-101, Aligned region: 769..822
IcmF-related [PF06761], Evalue: 9.10E-88, Aligned region: 539..842
DUF1215 [PF06744], Evalue: 6.60E-32, Aligned region: 953..1078
AAA_16 [PF13191], Evalue: 0.00078, Aligned region: 148..269
AAA_16 [PF13191], Evalue: 0.00078, Aligned region: 826..872
Protein Sequence: 1212 a.a.     [Download]
>gi|260595860|ref|YP_003208431.1| unnamed protein product [Cronobacter turicensis z3032]
MAARKLRMLNILLSIVTNRILWGFMGVTALSAVVWMIGPLLSIVDSRPLESETNRIISIALIYLIWVHSH
IVPRLYNAWLNRKLMDKLNEGKPAEEGGDFKRLGNDDQVLADRFDEAAQILKKAHFNAPGQRGQWTQRFS
TQYLYQLPWYVIIGAPGSGKTTALVNSGLQFPLADRFGKTALRGIGGTRNCDWWFTNEAVLLDTAGRYTT
QESEQAQDAGEWLSFVDLLRKYRRRQPINGVIITISVSDLLTQSPEATQQQAVNLRQRLGELHEQLGIRF
PVYVLVTKADLLKGFRSYFGRFDKAQRDQIWGFTFPWDRSKQADFDLLGAFTQEFALLQQRLDAGLPDTL
LAESDPKARAECYLFPQEFAALRPLLADYLSTVFARSNFETEFSPRGIYLASGTQEGLPFDRVMGELNRA
LSLPSGGKEGDNWDSVSKEAPIPGGKGQSFFIKNLLQNVIFQEAGIAGQNRWWELRNRAVLWSGYAALVA
LLLVLGGLWLTSYGNNKDYLAEVEGKVPGVERQSKALQTTTGRDLFSMLPFFNSLVELPKSKAFDLNSPP
VTYRMGLYRGDDVNDASQALYQKALQEMLMPAVAQLITGWVRNDNGSDVEYSYEALKAYQMLYQPKHYDG
KFLHSWVMLNLERNLPQNVTQAQLNQLEWHLTQLLEPQIQTSPYAKDESLISRQQAMINQKPLSLRVYGR
LKRLLERDENLKPVSLATLGGPQSELVFSRKSGKPVSDGVPGLYTPKGYWESFNGQIDNVTASLHDDDAW
VLGLTTAQEDKTQTDNAVRQLYMRDFISQWDSYLADIQLNNSADLNQRINTARVLSSSNSPLRRLVMNLS
QVLTLSRAEPQAGEAQAKEQGNRATRTLEALFSDRESGATTAAAAPQTPEQVVTDHYAPIIELAQPLEKG
GKAIVFDDFIKQIDELYRYLTAVQDAANSGMPPPGGEAISRLQASAGRLPGGLQNMFSRMAVGASSDTQQ
RELENVRKRISVEVGSFCRQAIAGRYPLVRSASSEVTPDDLARMFAPGTGLMDSFFRDNLTNKVDTTQQR
WRFTPGIDGKTLPGSEGVLRPFQQAQYIRDAFFANGATTPSYRVTVRTVRMDNDILTLSLDVDGQLLRYS
HGPQAVQLMSWPGSGGTNQVRMQLGLANGTTSTLVTNGAWALNRFFDRARIAPGAGSLSRQATFSVDGHS
VTLEFTPNSIRNPFQLPGFACP
 
Nucleotide Sequence: 3639 bp     [Download]
>gi|325295716|ref|NC_013282.2|:65522-69160 Cronobacter turicensis z3032 chromosome, complete genome
ATTGCCGCAAGGAAACTAAGGATGCTGAATATTCTCCTTTCAATAGTGACCAACCGCATCTTGTGGGGGT
TCATGGGCGTTACCGCGCTGTCTGCGGTCGTCTGGATGATAGGGCCCCTGCTGTCTATCGTCGACAGCCG
CCCGCTGGAGTCGGAAACCAACCGTATCATCAGCATTGCGCTTATCTACCTGATTTGGGTGCATAGCCAC
ATCGTGCCGCGGCTTTACAACGCCTGGCTGAACCGCAAGCTGATGGACAAACTCAACGAGGGCAAGCCGG
CGGAAGAGGGCGGCGACTTCAAGCGCCTCGGCAATGACGATCAGGTGCTGGCGGACCGTTTCGACGAAGC
CGCGCAGATCCTCAAAAAAGCGCACTTCAATGCCCCAGGCCAGCGCGGCCAGTGGACGCAGCGCTTCAGC
ACGCAGTATCTCTATCAGCTTCCCTGGTATGTGATTATCGGCGCGCCGGGCTCCGGTAAAACGACGGCGC
TGGTTAACTCCGGCCTGCAATTCCCGCTGGCGGATCGCTTTGGCAAAACCGCGCTGCGCGGCATTGGCGG
CACCCGCAACTGCGACTGGTGGTTCACCAACGAAGCGGTGCTGCTGGATACCGCCGGGCGTTACACCACG
CAGGAGAGCGAACAGGCGCAGGACGCCGGTGAATGGCTGAGCTTTGTCGATCTGCTGCGTAAATACCGCC
GCCGCCAGCCGATTAACGGCGTGATCATCACCATCAGCGTCTCTGACCTGCTGACCCAGTCCCCGGAAGC
GACGCAACAGCAGGCCGTTAACCTGCGCCAGCGTCTTGGCGAGCTGCATGAGCAGCTCGGTATCCGCTTC
CCGGTCTATGTGCTGGTCACCAAAGCCGACCTGCTGAAAGGCTTTCGTTCTTACTTCGGGCGCTTCGATA
AAGCGCAGCGCGACCAGATCTGGGGCTTCACGTTCCCGTGGGATCGCTCAAAACAGGCCGATTTCGACCT
TTTAGGCGCGTTTACTCAGGAATTCGCGCTGCTCCAGCAGCGTCTGGACGCGGGCCTGCCGGATACCCTG
CTCGCGGAGAGCGACCCGAAAGCGCGCGCCGAGTGTTATCTGTTCCCGCAGGAGTTTGCGGCGCTGCGTC
CGCTGCTCGCGGATTACCTCAGTACCGTTTTCGCCCGTTCCAACTTTGAAACCGAATTCTCGCCGCGCGG
GATTTATCTCGCGAGCGGCACCCAGGAAGGGCTGCCGTTCGACCGCGTGATGGGCGAACTCAACCGCGCG
CTGTCGTTGCCGTCAGGCGGCAAAGAGGGCGACAACTGGGATTCGGTCAGCAAAGAGGCGCCTATCCCCG
GCGGCAAAGGACAGAGCTTCTTTATTAAAAACCTGCTCCAGAACGTGATTTTCCAGGAAGCGGGCATCGC
CGGGCAAAACCGCTGGTGGGAGCTGCGCAACCGCGCGGTGCTGTGGTCTGGCTACGCGGCGCTGGTAGCG
CTGTTACTGGTGCTGGGCGGCCTGTGGCTTACGAGCTATGGCAATAACAAAGACTACCTGGCGGAAGTGG
AAGGGAAAGTGCCGGGCGTCGAGCGCCAGAGCAAAGCGCTGCAAACCACCACCGGGCGCGATCTCTTCAG
TATGCTGCCGTTCTTTAACAGCCTGGTGGAGCTGCCGAAGAGTAAAGCGTTTGACCTGAACTCGCCGCCG
GTGACGTATCGCATGGGGCTTTATCGCGGCGATGACGTCAACGACGCCTCGCAGGCGCTCTACCAGAAAG
CGCTCCAGGAGATGCTGATGCCCGCCGTGGCGCAGCTCATCACCGGCTGGGTGCGCAACGACAACGGCAG
CGACGTGGAATACAGCTACGAAGCGCTGAAGGCGTACCAGATGCTGTACCAGCCGAAGCACTACGACGGC
AAATTCCTGCACTCCTGGGTGATGCTCAATCTTGAGCGTAACCTGCCGCAGAACGTCACCCAGGCGCAGC
TTAACCAGCTCGAATGGCACCTGACGCAACTGCTGGAGCCGCAAATCCAGACCTCGCCGTATGCCAAAGA
TGAGTCGCTGATTAGCCGCCAGCAGGCGATGATCAACCAGAAGCCGCTGTCGCTGCGCGTGTATGGCCGC
CTCAAACGGTTGCTGGAGCGCGATGAAAATTTAAAGCCGGTGTCGCTCGCCACGCTTGGCGGCCCGCAGA
GCGAGCTGGTCTTTTCGCGTAAAAGCGGCAAGCCGGTCAGCGACGGCGTGCCGGGGCTCTACACCCCGAA
AGGTTACTGGGAAAGCTTCAACGGCCAGATTGATAACGTCACGGCTTCGCTGCATGACGACGATGCCTGG
GTGCTGGGACTGACCACCGCGCAGGAAGATAAAACGCAGACGGACAACGCGGTGCGCCAGCTCTATATGC
GCGACTTTATCAGCCAGTGGGACAGCTACCTGGCGGATATTCAGCTTAACAACAGCGCCGATCTGAACCA
GCGCATCAACACGGCCCGCGTGCTCTCCAGCAGCAACTCGCCGCTGCGCCGTCTGGTGATGAACTTAAGC
CAGGTGCTGACGCTCTCCCGCGCCGAGCCGCAGGCGGGCGAAGCGCAGGCGAAAGAGCAGGGCAACCGCG
CGACCCGCACCCTGGAAGCGCTGTTCAGCGACCGCGAAAGCGGGGCGACCACGGCCGCCGCCGCGCCGCA
GACGCCGGAACAAGTGGTGACCGATCACTACGCGCCTATCATCGAACTGGCGCAGCCGCTGGAGAAAGGC
GGCAAAGCTATCGTGTTTGATGACTTCATCAAACAAATCGATGAACTCTACCGTTACCTGACCGCCGTGC
AGGATGCCGCTAACAGCGGTATGCCGCCGCCGGGGGGCGAGGCGATCAGCCGCTTACAGGCGAGCGCCGG
GCGTCTGCCGGGCGGGTTGCAAAATATGTTCAGCCGCATGGCGGTCGGGGCGAGCAGCGACACCCAGCAG
CGTGAGCTGGAAAACGTCCGTAAGCGTATCAGCGTGGAAGTCGGCAGCTTCTGCCGCCAGGCGATCGCGG
GCCGTTATCCGCTGGTGCGCTCCGCCAGCAGCGAAGTGACGCCGGACGATCTGGCGCGCATGTTCGCGCC
GGGCACCGGGCTGATGGACAGTTTCTTTCGCGATAACCTGACTAACAAAGTCGACACCACCCAGCAGCGC
TGGCGCTTTACGCCAGGCATCGACGGCAAAACGCTGCCTGGCAGCGAAGGGGTGCTGCGTCCGTTCCAGC
AGGCGCAATATATTCGCGACGCGTTCTTCGCCAACGGCGCGACCACGCCGTCTTATCGCGTGACGGTGCG
CACCGTGCGGATGGATAACGACATCCTGACGCTGTCGCTCGACGTTGACGGTCAGCTTCTGCGTTACAGC
CACGGCCCGCAGGCGGTCCAGCTGATGAGCTGGCCGGGCAGCGGCGGCACGAATCAGGTGCGTATGCAGC
TCGGGCTTGCCAACGGCACCACCTCGACGCTGGTGACCAACGGCGCGTGGGCGCTGAACCGCTTTTTCGA
TCGCGCCCGCATTGCGCCGGGTGCAGGAAGCCTGAGCCGCCAGGCGACGTTTTCGGTTGACGGACATAGC
GTGACGCTGGAATTCACGCCGAACAGTATCCGCAACCCATTCCAGCTCCCTGGCTTCGCATGCCCTTAA
 Primer design